KEGG   Candidatus Paracaedimonas acanthamoebae: IM40_05760Help
Entry
IM40_05760        CDS       T03240                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
caq  Candidatus Paracaedimonas acanthamoebae
Pathway
caq00071  Fatty acid degradation
caq00072  Synthesis and degradation of ketone bodies
caq00280  Valine, leucine and isoleucine degradation
caq00310  Lysine degradation
caq00362  Benzoate degradation
caq00380  Tryptophan metabolism
caq00620  Pyruvate metabolism
caq00630  Glyoxylate and dicarboxylate metabolism
caq00640  Propanoate metabolism
caq00650  Butanoate metabolism
caq00900  Terpenoid backbone biosynthesis
caq01100  Metabolic pathways
caq01110  Biosynthesis of secondary metabolites
caq01120  Microbial metabolism in diverse environments
caq01130  Biosynthesis of antibiotics
caq01200  Carbon metabolism
caq01212  Fatty acid metabolism
caq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IM40_05760
   00630 Glyoxylate and dicarboxylate metabolism
    IM40_05760
   00640 Propanoate metabolism
    IM40_05760
   00650 Butanoate metabolism
    IM40_05760
  Lipid metabolism
   00071 Fatty acid degradation
    IM40_05760
   00072 Synthesis and degradation of ketone bodies
    IM40_05760
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IM40_05760
   00310 Lysine degradation
    IM40_05760
   00380 Tryptophan metabolism
    IM40_05760
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IM40_05760
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IM40_05760
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IM40_05760
Enzymes [BR:caq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IM40_05760
Exosome [BR:caq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IM40_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIL13122
UniProt: A0A077C3Y1
Position
1109253..1110440
Genome map
AA seq 395 aa AA seqDB search
MSKNEICIVAAKRTPMGAFQGVLSSVTALELGAHAIRSVLQDTPLPPSNIKEVIMGCVLP
ASLGQAPARQAAITAGLSSSVGATTINKVCGSGMKAIMLAHDQIKADEDSIIIAGGMESM
SNAPYLLLNARKGYRAGHDKLIDHMMYDGLEDAYKKGCSMGALGEIAVEQCQLTRNQQDE
FAALSAKRALQAINEGWFQAETSPISINFGKEVKMVAEDEPPTRVKFDKIPLLKPAFKEG
GTITAANSSPLTDGAAAVVLMTTSKAQEHNLSPRAIIRGHVTYSHDPDLFTLAPINAIKI
LLEKINWQIDDVNLFEINEAFALVPIAVIKELKLDINKVNIHGGACALGHPIGASGTRIV
VTLLHALEKYNLKRGIATLCIGGGEATAIAIERLE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaatgaaatttgtattgttgccgcaaaaaggacgccaatgggtgccttccaa
ggagtattaagttctgtcacagctcttgaacttggtgcccatgctattcgttctgtcctc
caagatactcccttacctccatctaacataaaagaagttattatggggtgtgttctgcct
gcaagtttggggcaagccccagcaagacaggcagcaataactgcaggcctttcatcgagc
gtaggtgccacaacaattaataaagtatgtggatcaggtatgaaagcaattatgcttgct
cacgaccaaattaaagccgatgaagattcaattatcattgcaggaggcatggaaagcatg
agtaatgctccttatctccttttaaatgcacgcaaaggatatcgcgcaggtcatgataaa
cttattgatcacatgatgtacgatggcctggaagatgcctacaaaaaaggctgctcaatg
ggggctttaggagaaatcgctgtagaacagtgccagttaacacgtaaccaacaagatgag
ttcgcagcactgtcagcaaagcgagctttacaagcaatcaacgagggttggtttcaagct
gaaacttcaccaatttcaataaattttggaaaagaagtcaaaatggttgcagaagatgaa
cctcctacacgcgttaagtttgacaagatccctcttcttaaacctgcctttaaagaaggt
ggaacaattacggcagcaaattcaagtcctcttacagatggtgcagcggctgttgtttta
atgaccacatctaaggcacaagaacataatctttctcctcgtgcgattattcggggtcac
gttacctattctcacgatcctgatttgtttacattggcacctatcaatgctattaaaata
ttacttgagaaaattaattggcaaatagacgatgttaatctgtttgaaattaatgaagct
ttcgcacttgttcctatagctgttataaaagagttaaaattagatattaataaagtcaac
atacatggtggggcttgcgcactaggtcatcccattggtgcaagtgggacacgcattgtt
gtcactctcctccacgccttagaaaaatataaccttaaacgaggtatcgcgactctttgt
atcggcggcggagaagcaacagctattgccattgaaagactagaataa

DBGET integrated database retrieval system