KEGG   Candidatus Paracaedimonas acanthamoebae: IM40_06315Help
Entry
IM40_06315        CDS       T03240                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
caq  Candidatus Paracaedimonas acanthamoebae
Pathway
caq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IM40_06315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:caq02022]
    IM40_06315
Two-component system [BR:caq02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   IM40_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AIL13200
UniProt: A0A077C0H0
Position
1213002..1213691
Genome map
AA seq 229 aa AA seqDB search
MVATSHLLVIDDDRRLRELLQKYLEENGYQVLVAASAQEARQQLIQELRLIVLDLMMPEE
SGLEFLKWLRHDMKNEIPVLMLTAMGEVDHRIEGLEAGADDYLAKPFEPRELLLRIRNLL
QRKSKLIFPGSAIRLGSLTYDPIRAILKCGDELIHLTSLEVTLMNIFSQQPGVPISREKL
AELSGVSLSPRTVDVQITRLRKKIEKDPKQPLYLHTVRHQGYVLRPDII
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacttctcatttgcttgttattgatgatgatcgtcgccttagagagctttta
caaaaatatcttgaagagaatggttatcaagttttagtggcagcttctgcacaagaggcg
cgacaacaattgatccaagaacttcgtctcattgtactcgaccttatgatgccagaagaa
tcaggacttgaatttttgaaatggcttcgacatgacatgaaaaatgagattcctgttttg
atgttgactgccatgggtgaagtagatcatcgtattgaaggcttagaggctggtgccgat
gattatcttgcaaaaccttttgaacctcgagaacttcttttaagaattcgtaatcttctt
caaagaaaatctaaattaatcttccctggctctgcgatacgcctgggctcacttacctat
gatccaatacgagctattctcaaatgcggagatgaattaatccatctaacttctctggaa
gttactttaatgaatattttctctcaacaaccaggggtcccaattagccgtgagaagctt
gctgaattaagtggagtcagcttaagcccaagaactgtggatgtccagattacaagactc
cgtaaaaaaattgaaaaagatcctaagcaacctctttatcttcatacagtgagacatcaa
ggatatgttttgaggcctgatataatatga

DBGET integrated database retrieval system