KEGG   Corynebacterium aurimucosum: cauri_1451Help
Entry
cauri_1451        CDS       T00887                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
car  Corynebacterium aurimucosum
Pathway
car00010  Glycolysis / Gluconeogenesis
car00520  Amino sugar and nucleotide sugar metabolism
car01100  Metabolic pathways
car01110  Biosynthesis of secondary metabolites
car01120  Microbial metabolism in diverse environments
car01130  Biosynthesis of antibiotics
car01200  Carbon metabolism
Module
car_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cauri_1451 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    cauri_1451 (ppgK)
Enzymes [BR:car01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     cauri_1451 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACP33044
UniProt: C3PGU0
Position
1610121..1610918
Genome map
AA seq 265 aa AA seqDB search
MTAQESQQQDTNPSPQHHGHAFGIDVGGSGIKGAVVDLATGEFVGDRLKIATPQPATPDA
VATVIAQIVAEKNWDGPVGITMPAVVKEQIIRSAANIDKSWIGVDAQDLLGKYLDAPFTV
LNDADAAGLAEVAYGDDVARSGPVIFLTLGTGIGSAFLLDGQLFPNTEIGHLIVGEKEAE
HQASSAVKDREGLKTKQWAKRVNRVLHEYEALFNPSAFVIGGGISRKFDKWGEHLSIETP
VVAAQLRNRAGIVGAAMAAKEGIRP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcaagaatcacagcagcaggacacgaatccgagcccccaacaccatggccat
gccttcggcatcgatgttggaggctccggcatcaagggtgccgtagtagacctcgcgaca
ggagaattcgtcggcgaccgcctcaagatcgccacgccacagcctgccacccccgacgcc
gtggccacggtaatcgcccagatcgtcgctgagaagaactgggacggccctgtcggaatc
actatgcctgcggtggtcaaagaacagattattcgcagcgcagcgaatattgataagtcc
tggatcggggtcgacgcgcaggatttgctgggcaagtacctcgatgcgccttttactgtg
cttaacgacgccgacgcggccggcctcgccgaggtggcctacggcgatgacgtcgcgcgc
tccggccctgtcatcttccttaccctgggcaccggcatcggctctgccttcctgttagat
ggccagctcttccccaatacagagatcggccacctcatcgtcggagaaaaggaggcagag
caccaagcctcgtccgcagtcaaggatcgtgaggggctgaagactaagcagtgggcaaag
cgcgtcaaccgagtactccacgaatacgaggctctttttaatccctcagcttttgtcatc
ggcggcggaatctctcggaagtttgacaagtggggcgagcacttgagcatcgaaactccg
gtcgttgcagctcagctccgcaatcgcgcgggcatcgtcggggccgcaatggcagcgaag
gaaggcattcgcccataa

DBGET integrated database retrieval system