KEGG   Corynebacterium aurimucosum: cauri_1711Help
Entry
cauri_1711        CDS       T00887                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
car  Corynebacterium aurimucosum
Pathway
car00020  Citrate cycle (TCA cycle)
car00310  Lysine degradation
car01100  Metabolic pathways
car01110  Biosynthesis of secondary metabolites
car01120  Microbial metabolism in diverse environments
car01130  Biosynthesis of antibiotics
car01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cauri_1711 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    cauri_1711 (sucB)
Enzymes [BR:car01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cauri_1711 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 DUF2254
Motif
Other DBs
NCBI-ProteinID: ACP33304
UniProt: C3PHK0
Position
1890856..1892556
Genome map
AA seq 566 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTILEIK
AEEDDTVDVGAVIAIIGDEGESAPAAEESEDSSEKAAETPDKPAEDAESEAPAASGDATD
VEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTLVEILAEED
DTVDVGAVIARVGDGSAAASEKPAAKEEKAEEKKEEPKAEEKKEEPKAEEKKPAASQSSE
PKTSETSTKVNNGDNVPYVTPLVRKLAEKHGVDLSTVSGTGVGGRIRKQDVLAAAGEGEA
PASSASASSSNPRARWSTKSVDPEKQELIGTTQKVNRIREITASKMVEALQISAQLTHVQ
EVDMTAIWDMRKQSKQAFIDKYEANLSFLPFIVKATVEALVSHPNVNASYNPETKEMTYH
ADVNVAIAVDTPRGLLTPVIHKAQELTLPEIAQKIAELADKARNNKLKPNDLTGATFTVT
NIGSEGALLDTPILVPPQAGILGTAAITKRAVVVTEDGQDAIAIRQMCYLPFTYDHQVVD
GADAGRFITTIKDRLETADFEADLDL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcacactctgttgtgatgcccgaactgggcgaatctgtaaccgaaggcacgattacc
cagtggctgaagtccgtcggcgacaccgtcgaggtcgacgagccattgctcgaggtctcc
accgacaaggtcgacaccgaaatcccctccccggtcgccggcaccatcctcgaaatcaag
gctgaggaagatgacaccgtagacgtgggcgcagtcatcgccatcatcggtgatgagggc
gagtctgcaccggctgctgaggagtccgaggattcctccgagaaagctgctgagaccccg
gacaagcctgctgaggacgctgagtctgaggctccggctgcttctggtgacgccaccgac
gtagagatgccggagctcggtgagtccgtcaccgaaggcaccatcacccagtggctgaag
tccgtcggcgacaccgtcgaggtcgacgaaccactcctcgaggtctccaccgacaaggtc
gacaccgaaatcccctccccggtcgccggcaccctcgttgaaatcctcgccgaggaagac
gacaccgtcgacgtcggcgccgtcatcgcccgcgtaggcgacggctccgccgcagcctcc
gagaagcccgccgccaaggaagaaaaggcagaggaaaagaaggaagagcccaaggctgag
gagaagaaggaagagcctaaggcagaagagaagaagcctgctgcttcccagtcctccgag
ccgaagacttctgagacttccaccaaggtcaacaacggcgataacgtcccgtacgtcacc
ccgctggtgcgcaagctggctgagaagcacggcgttgacctctccaccgtctctggcact
ggcgtcggcggccgcatccgcaagcaggacgtcctggccgcggctggcgagggcgaggca
ccggcttcctctgctagcgcatcctccagcaacccgcgtgctcgctggtccaccaagtcc
gtggatccggagaagcaggagctcatcggcaccacccagaaggtcaaccgtatccgcgag
atcacggcgtccaagatggttgaggccctccagatttccgctcagctgacccacgtccag
gaagtcgatatgaccgccatctgggatatgcgcaagcagtccaagcaggcgttcattgat
aagtacgaggccaacctctccttcctgccgttcattgtgaaggccaccgttgaggcactg
gtctcccacccgaacgtcaacgcgtcctacaacccggagaccaaggagatgacctaccac
gctgacgtcaacgtggccatcgccgtggatactccgcgtggcctgctgaccccggtcatc
cacaaggcccaggaactgacgctgccggagattgcccagaagatcgccgagctggcagac
aaggcacgcaacaacaagctcaagccgaatgatctgaccggtgcaaccttcaccgtgacc
aacatcggctccgagggcgccctgctggataccccgattctggttccgccgcaggccggc
atcctgggcaccgccgctatcaccaagcgcgcggtcgtcgtgaccgaggacggccaggac
gcgattgccatccgccagatgtgctacctgccgttcacctacgaccatcaggtggtcgac
ggtgccgacgctggtcgcttcatcacgaccatcaaggaccgcctcgaaaccgcagatttc
gaagccgaccttgacctctaa

DBGET integrated database retrieval system