KEGG   Corynebacterium aurimucosum: cauri_2168Help
Entry
cauri_2168        CDS       T00887                                 

Gene name
fadA2
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
car  Corynebacterium aurimucosum
Pathway
car00071  Fatty acid degradation
car00280  Valine, leucine and isoleucine degradation
car00310  Lysine degradation
car00362  Benzoate degradation
car00380  Tryptophan metabolism
car00620  Pyruvate metabolism
car00630  Glyoxylate and dicarboxylate metabolism
car00640  Propanoate metabolism
car00650  Butanoate metabolism
car00900  Terpenoid backbone biosynthesis
car01100  Metabolic pathways
car01110  Biosynthesis of secondary metabolites
car01120  Microbial metabolism in diverse environments
car01130  Biosynthesis of antibiotics
car01200  Carbon metabolism
car01212  Fatty acid metabolism
car02020  Two-component system
Brite
KEGG Orthology (KO) [BR:car00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    cauri_2168 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    cauri_2168 (fadA2)
   00640 Propanoate metabolism
    cauri_2168 (fadA2)
   00650 Butanoate metabolism
    cauri_2168 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cauri_2168 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    cauri_2168 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cauri_2168 (fadA2)
   00310 Lysine degradation
    cauri_2168 (fadA2)
   00380 Tryptophan metabolism
    cauri_2168 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cauri_2168 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cauri_2168 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cauri_2168 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:car04147]
    cauri_2168 (fadA2)
Enzymes [BR:car01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cauri_2168 (fadA2)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cauri_2168 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ACP33761
UniProt: C3PIV7
Position
2360471..2361769
Genome map
AA seq 432 aa AA seqDB search
MTNPPHRVAILGGNRIPFARSNTQYAHASNQDMLTSALDGLVARYGLHDERLGLVAAGAV
LKHSRDFNLTRESVLGSALDSTTPAIDVQQACCTSLAAAIHVGDAIAQGRISAGIAGGTD
TTSDAPLAVNDTLRRTLLNLTRAKTAAQRAQLVGSIRPSQLAPEQPQNGEPRTGLSMGDH
AAITAREMNVSREAQDELALASHQNLHKAWEEGFFDDLTTGFLGVNRDTNLRPDSSLESL
AKLKAVFGKRDAEQHGAQATMTAGNSTPLTDGASVALLSSEEWAVEHNIEPRAFLLDSET
AAVDFVHGPDGLLMAPTYAVPRLLERNNLSLQDFDFYEIHEAFASQVLATLSAWEDETYC
RERLGLQSALGSIDRAKLNVKGSSLAAGHPFAATGTRILATTAKILEENGGGRALISICA
AGGQGVAAIVER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccccccgcaccgcgtagccatcctcggcggcaaccgcattccctttgctcgc
tccaatacgcagtacgctcacgcgtccaaccaagacatgctcaccagtgcgctcgacggc
ctcgtggcacgctacgggctgcacgacgaacgcctcggcctcgtcgccgccggcgctgtg
ctcaagcactcccgcgatttcaacctcacccgcgaatccgtactcggctctgccctcgac
tccacgactccagctattgacgttcagcaggcctgctgcacctccctggcggcagccatc
cacgtcggcgatgccatcgcccaaggtcgcatctccgccggcatcgcaggaggcacggac
accacctcagacgccccgctggccgtcaatgacaccctgcgccgcacattgctaaacctc
acccgcgccaagaccgccgcgcagcgcgctcagctcgtcggctccatacgcccgtcgcag
ctagccccggaacagccgcagaatggcgaacctcgcaccgggctctccatgggtgatcac
gccgccatcaccgcccgcgagatgaacgtcagccgcgaagcccaggacgagctggcactc
gcctcccaccagaacctccacaaggcctgggaggagggcttcttcgatgacctcaccacc
ggcttcctcggtgtcaatcgcgataccaacctgcgcccggactcttccctagagtcccta
gccaaactcaaagcggtctttggtaagcgcgacgccgagcagcacggcgcgcaggccacg
atgactgcaggcaactccacgccgctgaccgacggcgcctccgtcgccctcctcagctct
gaagagtgggcggtcgagcacaacatcgaaccccgcgccttcctgctggattccgagacc
gcggcagtcgactttgtccacggccccgatgggcttctcatggcccccacctacgcagtc
cctcgcctcctggagcgcaacaatctgagcctccaagatttcgatttctacgagatccac
gaggccttcgcctcccaggtactcgccaccctgtccgcatgggaagacgaaacctactgc
cgcgaacgcctgggcctgcagtctgcactcggctccatcgaccgcgccaagctcaacgtc
aagggctcttccctagctgccggccaccccttcgccgccaccggcacccgcatcctcgcc
accaccgccaagattcttgaggaaaacggcggcggacgcgccctcatttccatctgcgcc
gccggcggccagggtgtcgcagccatcgtcgagcgttaa

DBGET integrated database retrieval system