KEGG   Carnobacterium sp. CP1: NY10_1328Help
Entry
NY10_1328         CDS       T04230                                 

Definition
(GenBank) Cell wall-binding protein
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3D DUF4407 Borrelia_P83 Spc7
Motif
Other DBs
NCBI-ProteinID: ALV21936
UniProt: A0A0U3PNI3
Position
complement(1383525..1384709)
Genome map
AA seq 394 aa AA seqDB search
MKIGKLVASSIIAFLLITVSPSTAFAATLDEITSKQQAKQEEMAKLDSEVSQTLVKVNEK
NTELENLNAKIEEKKGNIEQTSTEIDEQEEVVQARVDQAKERLQTIQTSEVNQNVIVSLF
ESESVSDLFNRAYILATLQTAGNDQLSLAEEEQEKLADLKEKLNEEAIALENQTQAAEEQ
KADLDKQVAGLQKTMDENQDILNELDSEKRAEETRIAEAKKAEEEAAAEKIKVAQTAAKA
EKEKASQAAGQAKAEATKEAAEVKPEAKVEAAPAETKTTETASPKTEAKQPAESAPAAST
GKTLVVSATGYSTAEAGLSTHTATGIDLRSTPMVIAVDPRVIPLGSMVEVPGYGVAIAGD
TGGAIKGNKIDVHFSSVEQAFAWGRKTVTIKVLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattggtaaattagttgcaagctcaataatagcctttttattgattactgttagt
ccaagtactgcatttgctgcaacgttagacgaaattacatctaaacaacaagccaaacaa
gaagaaatggcaaaattagatagcgaagtcagccaaacattagttaaagtaaacgaaaag
aatactgaacttgaaaatttaaacgcgaaaatagaagagaaaaaaggaaacattgaacag
acttcaactgagatcgatgaacaagaagaagttgttcaagcacgtgttgatcaagctaaa
gaacgtctgcaaaccattcaaacttctgaagttaatcaaaatgtgattgtttcattattt
gaatcagaaagtgtttcagatttatttaatcgggcttatatcttagcaactttgcaaact
gctggaaatgatcaattgagtttggcagaagaagagcaagaaaagttagctgatttaaag
gaaaaattaaatgaagaagcgatcgcgttagaaaaccaaacacaagcagctgaagaacaa
aaagctgatttagataaacaagtggctggtttacaaaaaacgatggatgaaaaccaagat
attttgaatgaattagacagtgagaaaagagcagaagaaacgagaattgctgaagctaaa
aaagctgaagaagaagctgctgctgaaaaaatcaaagtagcgcaaacagctgccaaagca
gaaaaagaaaaagctagtcaagctgctggtcaagcaaaagcagaagcgacaaaagaagct
gcagaagtgaaaccagaagcaaaagttgaagctgcaccagcagaaactaaaacaactgaa
actgctagtccgaaaacagaagcgaagcagccagctgaatctgctccagcagcttcaaca
ggcaaaacactagttgtatctgcaacaggctactctacggctgaagcaggattaagcaca
catacagctactgggatcgatttaagaagcacaccaatggttatcgctgtagatccgcgt
gtgatcccattaggatcaatggtggaagttccaggatatggtgtagccatcgctggcgat
acaggcggagcgattaaagggaacaaaatcgatgtccacttctcatcagtcgaacaagct
tttgcttggggaagaaaaacagtaaccattaaagtgttaaactaa

DBGET integrated database retrieval system