KEGG   Carnobacterium sp. CP1: NY10_1329Help
Entry
NY10_1329         CDS       T04230                                 

Definition
(GenBank) Nucleoside 2-deoxyribosyltransferase
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nuc_deoxyrib_tr Nuc_deoxyri_tr2 LDcluster4 DUF4760
Motif
Other DBs
NCBI-ProteinID: ALV21937
UniProt: A0A0U2VKJ2
Position
1384866..1385345
Genome map
AA seq 159 aa AA seqDB search
MLKKAYFASPLFSEMEVMYNKYVVSEIKKTFSDLELYVPQDQEEINDKNAYADSIMIAKL
DTDQLLSCDFMIAVLDGAAIDVGVATEIGVAYQAGIPIIGLYTDSRQQGATNQKKLDALQ
EIAESQFSYINLYTVGIVKTNGTIVNTIDELIKAITPYC
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaaagcttattttgccagccctttattttctgaaatggaagtgatgtacaat
aagtatgtcgtcagtgaaataaaaaaaactttctcggatttagagttatatgtgccccaa
gatcaagaagaaatcaatgataaaaacgcttatgccgattcaatcatgattgctaaactt
gatacagaccaattgctgagttgtgattttatgatagctgtcttagatggagctgctatt
gatgttggtgtggctactgaaattggcgtagcttaccaagcggggattccaattattggt
ctctataccgattcaagacagcaaggcgcaactaatcaaaagaaattagacgccttgcaa
gaaatcgctgaatcccaattttcttatatcaatctttatactgttggaatcgttaaaaca
aacggaaccattgtcaatacgattgatgaattaattaaggctattacgccttattgttaa

DBGET integrated database retrieval system