KEGG   Carnobacterium sp. CP1: NY10_1330Help
Entry
NY10_1330         CDS       T04230                                 

Definition
(GenBank) Permeases of the major facilitator
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 Pox_A14
Motif
Other DBs
NCBI-ProteinID: ALV21938
UniProt: A0A0U3MSL5
Position
1385612..1386775
Genome map
AA seq 387 aa AA seqDB search
MMTLLLMIIFTSFISLGLPDSLLGAAWPVMHLDLGVPLANAGSLSMVISGGSILSSLFSG
KLIARFGTGKLTLISVLMTAVALFGFYSLPSFFWLVIAAIPLGLGGGAVDAGLNNFVALH
YRAQYMNWLHCFWGVGATIGPIILAYFIGQNNQWRKGYLAISIIQFILVVILFLSLPLWK
KVETDLLESQPESKKNESKNLFKVKGIFPALISFFSYSAVETTAHVWGSSYLVNYQAIPA
KTAANWLSLFFVGITLGRFIAGFLTIKITSKHLMRAGSLAILAGSLLMILPLPSIFLMIG
LILIGLGCAPIYPAMVHETPQRFGKTLSQSIIGFQMAFAAIGSMTMPLFFGFLTTKFSMS
IYPYFLLVSALVMIASTERINYSSKKG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctgcttttaatgattatctttacttcttttattagtttaggcttacctgat
tctttactaggtgctgcatggcctgtaatgcatctagatttaggtgttcctttggcaaat
gccggcagtctttctatggttattagcggaggatcgattctctccagtctcttcagcgga
aaattgattgcacgtttcggtaccgggaagttgacattgatcagtgtccttatgacagca
gtggcactcttcggcttttattcactgccttcttttttctggttggttattgctgctatc
ccacttggcttaggcggcggagcagttgatgccggcttaaataattttgttgcgctgcat
taccgagcacaatatatgaactggcttcattgtttttggggcgttggtgcaacaataggc
ccaattattcttgcttactttataggccagaataaccaatggcgaaaaggttaccttgcc
atttcaattattcaatttattttagtcgtcatcctatttctctctctccctttatggaaa
aaagtcgaaacggatttgttagaaagccaacctgaaagcaaaaagaatgaatctaaaaac
ttatttaaagttaaagggatttttcctgccttaatttcttttttttcttatagtgctgtg
gaaacgactgctcatgtctgggggagcagctacctagtgaattatcaagctatccccgca
aaaactgctgcaaattggctttccttgttttttgtcggcattactttgggacgcttcatt
gccggatttcttacgataaaaataaccagcaaacacttaatgagagctggatcacttgct
attctagctggcagtcttttaatgatccttccattgccatctatctttttaatgattggt
ttgatattgattggattaggctgtgcgcctatttaccctgctatggtgcatgagacacct
cagcgtttcgggaaaactctttctcaatccattattggatttcaaatggctttcgcagcc
attggcagtatgacgatgcctttgtttttcggttttttgacaacaaaattcagtatgtct
atttatccttattttctcttggttagtgccctcgttatgatcgccagtacagaacgtatc
aattactcttctaaaaaaggataa

DBGET integrated database retrieval system