KEGG   Carnobacterium sp. CP1: NY10_1332Help
Entry
NY10_1332         CDS       T04230                                 

Definition
(GenBank) Branched-chain amino acid transport system carrier protein
  KO
K03311  branched-chain amino acid:cation transporter, LIVCS family
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NY10_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Branch_AA_trans
Motif
Other DBs
NCBI-ProteinID: ALV21940
UniProt: A0A0U3P4I9
Position
complement(1387705..1389066)
Genome map
AA seq 453 aa AA seqDB search
MEKKLSLSSYFYLGSMLFGLFFGAGNLIFPVHMGQLAGANVSWATWGFLLTGIGLPFLGV
VAIGVSNSNGLFELSSRVHPYYGYFMTIALYLTIGPFFALPRTGTVSYEIGLSPYISTQY
QTLGLAIFTLLFFGAALLFSLKPTKILVYVGKVLNPIFLVFLGILMITAFIKPLGGIATA
PITGEYATAPFASGFTEGYNTMDALASLAFGIIVVQTIKGMGITKPAAIAKDTIKSGLIS
LVLMGVIYGSLSYLGTMSIGQFPVSENGGIALTQIARYYFGSFGSVLLAIIVTVACLKTA
IGLITACAETFREMFPNSISYKAYVILFSAVACLVGNVGLTKIIAYSIPVLMFLYPLAIT
LILLALLSPLFKNRQIVYGMTTLLTIFVSIADMLNALPEPIHNLDGVQTILNFYSHYLPF
FDSGMGWILPATVGLIIGWLISLVTKPNPKMIH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaagttatcgctatcttcttatttttatcttggttcaatgctctttggacta
ttctttggagctggaaatttaatttttccagttcacatgggacaattggcaggcgctaac
gtcagctgggccacatggggattcttattgacgggtattggtctcccgtttttaggagtc
gtagctattggtgtctccaatagtaatgggttgttcgaattatctagtcgtgtacaccct
tattatgggtattttatgaccatcgctctctacctaacgatcggaccgttttttgcattg
ccaagaaccggtacagtatcttatgaaatcggcttgtcgccttatataagcactcaatac
caaacgttagggttagctatttttacattgttgttttttggagcagcactactgttttcg
ttgaagccgacaaaaattttagtttatgtaggaaaagtattaaatccgattttcctagtg
tttttaggtattttaatgattacggcctttataaaacctttaggaggaattgcgacagca
cctatcacaggtgagtacgcaacggcgccattcgccagcggctttaccgaagggtacaat
accatggatgctttagcatcattagcttttggaattattgttgttcaaacgatcaaagga
atgggcattactaaaccggctgcgattgcgaaagatacgatcaaatcaggtttgatcagt
cttgttttaatgggagtcatctatggtagcttatcttatctcggtacgatgagtatcggt
cagtttccggtttctgaaaatggaggaatagcgctgacgcagattgcgcgttattacttc
ggctcattcggcagtgtcttattagccatcatcgttacggtagcttgtcttaaaaccgcg
attggtttgatcactgcttgtgcagaaaccttccgagagatgtttccaaattcaatcagt
tataaagcttacgtcattctttttagcgctgtcgcttgtttagttgggaacgtcggattg
actaagatcatcgcttattccatcccggtattgatgttcttgtacccgttggcgattacg
ttgattttgttagctttgctttcgcctttattcaaaaatcggcaaattgtttatggcatg
accactcttttgactatttttgtcagtattgccgatatgttaaatgctttgccagagcct
atccataatttggatggagtacagaccattttgaatttctatagtcattatctgccattt
ttcgatagcggcatgggctggatactgccggcaacggtcggcttgatcattggctggctg
atcagtttagtaacgaaacctaatccgaaaatgatccattga

DBGET integrated database retrieval system