KEGG   Carnobacterium sp. CP1: NY10_1334Help
Entry
NY10_1334         CDS       T04230                                 

Definition
(GenBank) amino-acid ABC transporter permease protein yckA
  KO
K10009  L-cystine transport system permease protein
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:carc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NY10_1334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:carc02000]
    NY10_1334
Transporters [BR:carc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    NY10_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALV21942
UniProt: A0A0U3E7M0
Position
complement(1390316..1390996)
Genome map
AA seq 226 aa AA seqDB search
MSDIQWQYIFDPALALDSLPYVLKGLGYTLGISVSSMIFGTLLGFLLAIMRMSSFKPLRI
IAKIYISFMRGTPTLVFLFILYFGFPFIGIQFEAINAAVIGFSLSSSAYIAEIIRSALAS
IDKGQWEAAYALGLKWSFIMRKVIVPQAMRVAVPPLSNVLLDLIKGTSLAAMITVPEIFQ
QAKIVGGREFDYMTMYILVALVYWAICSLFTIFQNYLEKKTAVYTN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatccaatggcaatacatttttgatcctgctttagccctcgacagcttgcct
tatgttttgaaagggttaggttacactttaggaatctcagttagcagtatgatttttggg
acactgctaggatttcttttagcaattatgcggatgtcttcttttaagcccttaagaata
atcgcaaaaatctatatttcatttatgcggggaacgccaacattggtttttctgtttatt
ctctactttggtttcccttttatcggcattcaatttgaagctatcaatgcagccgtcatc
ggtttcagtttgagttccagtgcctatattgctgaaatcattcgttctgctttagcttcc
attgacaaaggacaatgggaagcggcttatgcattaggattgaaatggtctttcatcatg
cgcaaagtaattgttccgcaagctatgcgtgttgctgttccgccattaagcaatgtctta
ctggatctaatcaaaggaacttctctagcagcaatgattacggttcctgaaatctttcaa
caagcaaaaatcgttggcggccgtgagtttgattatatgaccatgtatattttagttgct
cttgtgtattgggccatttgtagtttgtttacgattttccaaaattatttggaaaagaag
acggcagtttataccaattaa

DBGET integrated database retrieval system