KEGG   Carnobacterium sp. CP1: NY10_1337Help
Entry
NY10_1337         CDS       T04230                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH ADH_zinc_N AFOR_C IlvN XdhC_C
Motif
Other DBs
NCBI-ProteinID: ALV21945
UniProt: A0A0U3NN01
Position
complement(1393119..1394081)
Genome map
AA seq 320 aa AA seqDB search
MTKKGIWLAQETTPEQLNTLKKLAPDYELIEAWNDNDFDFPLEDIEIIYGWKGQKSSELL
TNNKSRLNWVQGKAAGVDFLDLDGLKEKDVLLTNGSGIHSISIAESVFGMLLAYARGIQE
AIRNQTTKTWHQTDRLMELHDKTMMIVGTGNIGKEVGRLAKAFGMKTIGVNRSGHEAANM
DVVIPQKDLVKKVSEADIVVNILPLTDKTTHFFNDTVFNAMQKRTLFLNVGRGPTVDTSH
LIAALDTEQVAFAGLDVFETEPLETESPLWERSDVLITPHISGIAEHFKKRLFAIFEENL
QAYLAGEELPKNLVDYERSY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaggcatttggttagcccaagaaacaacaccagaacaattaaatacatta
aaaaaactcgcaccagattatgaactgatcgaagcatggaacgataacgattttgatttt
ccattggaagatattgaaatcatttacggttggaaaggccaaaagagcagtgaattgtta
acaaataacaaaagccgattgaattgggttcaagggaaagcagcaggagtcgacttctta
gacttagacggtttaaaagaaaaggatgttttactgactaacggaagcggcatccatagc
atttcgattgcagaatctgtttttggaatgttattagcttatgcaagagggattcaagaa
gccatccgaaaccaaaccactaaaacttggcatcaaacagatcgtttaatggaattgcac
gataaaacgatgatgatcgttggaacggggaatattggcaaagaagttggacgtttggct
aaagcatttggaatgaaaaccattggtgtaaaccgcagcggacacgaagcggctaacatg
gatgtagtcatacctcaaaaagacttggtcaaaaaagtttcggaagcggatattgtggta
aatattctgcctttaaccgataaaacaactcatttcttcaatgacacagtatttaatgct
atgcaaaaaagaacgctctttttgaatgtgggacgaggcccgacagtcgatacttcacat
ttaatagcagctttagacacagagcaagttgcttttgccggattagatgtttttgaaacg
gaaccgttggaaacagaaagtccgttatgggaacgtagcgatgtgttgattactccacac
atttcggggatagcagaacacttcaaaaaacgcttgtttgctatttttgaagaaaatttg
caagcatatctagccggagaagaattgcctaaaaacctagttgattatgaacgtagttat
tga

DBGET integrated database retrieval system