KEGG   Carnobacterium sp. CP1: NY10_1340Help
Entry
NY10_1340         CDS       T04230                                 

Definition
(GenBank) hypothetical protein
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALV21948
UniProt: A0A0U3NQW7
Position
complement(1397267..1397602)
Genome map
AA seq 111 aa AA seqDB search
MIIYNIHTESDLSGVAFQYSQDVEVIESDYFQQIEAARPIILEADFLFLKGVADARGYIE
IGIGLALNKKIIILEDPFIKHTSIDPELMIEGTTIHKMTIQEFSDWTDQVN
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgattatttataatatccatacagaaagtgatttaagcggcgttgcttttcaatattct
caagacgtagaagtgattgaatcagattactttcaacaaatagaagctgccaggccgatt
attttagaagccgattttctttttcttaagggagtagcagatgctagaggctatattgaa
ataggcatagggctggctttgaataaaaaaatcattatcctagaggatccttttatcaaa
cacactagcatcgacccggaacttatgatagaaggtacgactatccataaaatgacgatc
caagaattttcagattggacggaccaagttaactga

DBGET integrated database retrieval system