KEGG   Carnobacterium sp. CP1: NY10_1344Help
Entry
NY10_1344         CDS       T04230                                 

Definition
(GenBank) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00250  Alanine, aspartate and glutamate metabolism
carc00460  Cyanoamino acid metabolism
carc01100  Metabolic pathways
carc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NY10_1344
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NY10_1344
Enzymes [BR:carc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     NY10_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase Asparaginase_C
Motif
Other DBs
NCBI-ProteinID: ALV21952
UniProt: A0A0U3PNI9
Position
1400179..1401144
Genome map
AA seq 321 aa AA seqDB search
MKTILVLHTGGTIAMSEDQTTGKVRPNAENPLQKHSHLFDQEAHLIVEDFFQLPSPHITP
KEMLLLKKRIEKAILSKEADGVVITHGTDTLEETAYFLDLTLDHQVPIVITGAMRSSNEI
GSDGLYNFQSAVWVALADEAQNKGVLVVMNDEIHTARYVTKTHTSNVATFQTPTFGPIGL
ISKNEVLFFQKLIAEEKFEITTVDKSVYLLKAYSGMDGVLFDALNNDQTDGLIIEALGAG
NLPPATLPALQRILNRNIPVVLVSRSFNGIAQDVYDYPGGGKRLSEAGVIFTNGLTGPKA
RIKLMVALNKTQNLEEIAQYF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactattctagttttacacactggaggaacgattgcgatgagcgaagaccaaacc
actggtaaagttcgtccaaatgcagagaacccgttacagaaacacagccatttatttgac
caagaagctcatttgatcgtggaggatttttttcaactcccttctcctcacatcacgcca
aaagaaatgttgttgttaaaaaaacggatcgaaaaagccattttgtcaaaagaagctgac
ggtgtcgtcattacacatggaaccgatacgttagaagaaacagcttactttttagattta
acactggatcatcaagtgcccatcgtcatcacgggagctatgcgttccagcaatgaaatc
ggctctgatggtctttacaactttcaaagcgctgtttgggttgctttagcagatgaagct
caaaacaaaggcgtgctggtagttatgaacgatgagatccatactgcccgctatgtgaca
aaaacacatacatcaaacgtcgcaactttccaaaccccgacttttgggccgattgggctt
atttctaaaaatgaggtcctttttttccaaaaattgattgcagaagaaaaattcgagatc
acgactgtggataagtccgtttacctcttaaaagcctattctgggatggatggcgtttta
tttgatgctctaaataatgaccaaaccgacgggctgatcattgaagcgcttggtgccgga
aatttaccgccagcgactctgccggcattgcagcgtattttaaatcgaaacattcctgtt
gttttggtttcacgctctttcaacggcattgctcaagacgtctatgattatcctggcggc
ggtaaacggttgagcgaagctggcgttattttcaccaatggtctgactgggcctaaagcc
cggatcaaattaatggttgctctaaataaaactcaaaatcttgaagaaattgctcagtat
ttttaa

DBGET integrated database retrieval system