KEGG   Carnobacterium sp. CP1: NY10_1345Help
Entry
NY10_1345         CDS       T04230                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00052  Galactose metabolism
carc00500  Starch and sucrose metabolism
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NY10_1345
   00500 Starch and sucrose metabolism
    NY10_1345
Enzymes [BR:carc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NY10_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_130
Motif
Other DBs
NCBI-ProteinID: ALV21953
UniProt: A0A0U2VKL7
Position
complement(1401191..1402573)
Genome map
AA seq 460 aa AA seqDB search
MTRTKNRGEYELGYHITPPKGLLNDPNGLIQFKGVYHVFYQWNQNDTTHNTKSWGHVAST
DLIHWTEQPAALEPVDWFDKDGCYSGSAVSFENKLYLFYTGNVRNEANERESYQCLAVSE
DGVHFEKKGPILKQPAGYTAHVRDPKVWQGKNNDWWMVLGAQKVDLTGDALVYHSKNLID
WTCTGSLLDDELDFGFMWECPDLVHFNQKSAFIFSPQGIMARGDEFNNIYQSGYLTGVFT
EAGKFLTDEQPFKELDRGFEFYAPQTFQDDKGRQLLFGWMGVMEPAIEAAVPTIQDGWIH
SLTIPRELIYADGQLNQRPAAELKQLRHGSPLVVEGKAEASLQLPTLQNEILVDWEKTAG
SFKLQIRKDVDIEYDQHRNRVQVSRSNWLTGDRETRAVTLTKPLTQLHLFLESSSLELFV
NQGEEVFSLRYFPEQEARTVDVDACETGKEPQITLYTLEN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactaaaaatagaggagaatatgagctgggttatcacattacgcctcctaaa
ggcttgttgaatgatcccaatggattgattcaatttaaaggggtctaccatgtcttttac
caatggaaccaaaacgatacgacccataataccaaaagttgggggcacgttgcttcaacg
gatttgattcattggaccgagcagccagcagctttggaaccggtcgattggtttgataaa
gatggctgttattccggcagtgctgtatcttttgaaaataaattgtatttgttctatacc
ggaaatgtccgaaacgaagcgaatgaacgcgaaagctatcaatgtttagctgtttcagaa
gatggcgtgcattttgaaaagaaagggccgattttgaaacagcccgcgggatacacagca
catgtgagggatccaaaagtttggcaaggaaagaataacgattggtggatggtattaggg
gcacaaaaagttgatttgacgggggatgctttggtgtatcattcgaagaatctaatcgat
tggacatgcacaggttcgcttttggatgatgagcttgattttggatttatgtgggaatgt
ccggatttagtgcacttcaaccaaaaatcagcgtttattttttctccacaaggaatcatg
gcccgaggagatgagtttaacaatatttatcaatccggttatttaactggggtatttaca
gaagcaggcaaatttttaaccgatgagcagccttttaaagagttggatagagggtttgaa
ttttacgctccgcaaactttccaagacgataaaggacgtcagcttttatttggttggatg
ggagtcatggaaccagcaattgaagcagctgttcccactatccaagacggctggatccac
tctttgacgattcctagagaattgatttatgctgatggacaattaaaccagcggccagca
gcagaattgaaacaattaaggcatggttctcctttagttgtggaagggaaagccgaagca
tcactgcagctgcctacattgcaaaatgagattctggtagactgggagaaaacggccggt
tcattcaagcttcagataagaaaagatgttgacattgagtacgatcagcaccgaaaccga
gtgcaggtttcgcggtcaaattggctgactggcgatagagagacccgggcggtcacattg
acaaagcctttgacgcaactgcacttgtttcttgaaagttcttcgttggaattgtttgtt
aaccaaggggaagaagttttctccttgcggtatttcccggagcaagaagcaaggacagtt
gatgtggatgcgtgtgaaacgggtaaagaaccccaaatcacattgtacactctagaaaat
tga

DBGET integrated database retrieval system