KEGG   Carnobacterium sp. CP1: NY10_1347Help
Entry
NY10_1347         CDS       T04230                                 

Definition
(GenBank) Sucrose operon repressor ScrR, LacI
  KO
K03484  LacI family transcriptional regulator, sucrose operon repressor
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:carc03000]
    NY10_1347
Transcription factors [BR:carc03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    NY10_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4 HTH_3 HTH_7 HTH_IclR TetR_N O-FucT HTH_10 HTH_19 HTH_24 HTH_38 HTH_5 MarR_2 HTH_31
Motif
Other DBs
NCBI-ProteinID: ALV21955
UniProt: A0A0U3P2W3
Position
complement(1404143..1405123)
Genome map
AA seq 326 aa AA seqDB search
MVTINDIAKRANVAKSTVSRYLNGGSVSQKTKEKLNQIVAETGYTPNTFAQSLKAKKTNM
IGTIIPRLDSYSANEALASIDEELRERNFQLLITNTNQLSAREIESIYSLAKQKVAGILL
FATVITEEHKKAITEVGIPVILLGQQAEGFYHIVHEEYQAGYKLGKYATRLGHKDFLYLN
VFEADVAVGQLRKNGVLAALKEEKESSVEMVEVSFSFEKAYEQALKLLPTLKATYIFCAT
DNIALAVLKAAHKLGLEVPTAFSLSGFGGYQITSIVTPSITTVKYAYKELGQVAVQNLIK
LLDGEEVPEEVQLTNELIANESTQQY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccatcaacgatatcgctaaacgtgcaaatgtcgcaaaaagcacggtttcaagg
tacttaaatgggggttctgtcagtcaaaaaacaaaagagaaattaaatcaaattgtggcc
gagactggttatactcctaatacatttgcgcaaagcctaaaagcgaaaaaaacgaatatg
atcggcaccattatcccacgattggattcttattcagccaatgaagcgttagcctctatt
gatgaagaactgagagaacgcaattttcaattattgatcaccaatacgaaccagttgtcg
gctagagaaattgagagcatttattctctagctaagcaaaaagtagcaggcattctttta
tttgctacagtgattacagaagagcacaaaaaagccatcacagaagtaggcataccggtt
attttgttaggccaacaagcagaaggtttttaccatattgttcatgaagagtaccaagcg
ggttataagttgggaaaatacgctactcgtttaggccataaagactttttatacctaaac
gtttttgaagcagatgttgcagttggacagttacgaaaaaatggtgttttggctgcgtta
aaggaagaaaaggaaagttctgtagagatggttgaagtaagcttttcttttgaaaaagct
tacgaacaagcattaaaattgttgcccacgttaaaagcaacatatatcttttgtgcaacc
gacaatattgcgctagcggttttaaaagcagcacacaaactaggattagaagttccaaca
gctttttcattatctggtttcggagggtatcagattacgtccattgtgactccctcgatt
accaccgtaaaatatgcctataaagaattagggcaagtagcggtgcaaaacctgattaaa
ttgcttgatggcgaagaggttcctgaagaagttcagctaaccaatgaattgattgcaaat
gaatccacccaacagtactga

DBGET integrated database retrieval system