KEGG   Carnobacterium sp. CP1: NY10_1348Help
Entry
NY10_1348         CDS       T04230                                 

Definition
(GenBank) Acyl-ACP thioesterase
  KO
K01071  medium-chain acyl-[acyl-carrier-protein] hydrolase [EC:3.1.2.21]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00061  Fatty acid biosynthesis
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NY10_1348
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:carc01004]
    NY10_1348
Enzymes [BR:carc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     NY10_1348
Lipid biosynthesis proteins [BR:carc01004]
 Fatty acid synthase
  Component type
   NY10_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-ACP_TE 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ALV21956
UniProt: A0A0U3P4K2
Position
complement(1405128..1405895)
Genome map
AA seq 255 aa AA seqDB search
MTNQIFEKEHQVSYYECDATRRITIPMLINIMMHVSGEQSHALGVGDEQLNDKGLAWIVL
QYEMNITQVPEFYKTIKVTTQAMSYNKLFCYRDFNVYDEAGNLCVTAHSTFALLDVTQRK
MVRIQDEVVAPFEAEFSKKLIRTPKPEKVADELTVSNEYRVRYLDIDSNQHVNNSKYIDW
AMDTLDYEFLTTHKLTYLNIKFEKEVYYGDRIQSQMSLHEAENGKIVSAHRIVTGSTTNS
EASMVWEKSEDEVSR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccagatttttgaaaaagaacaccaagtcagctactacgaatgtgatgcaaca
cgtcgaatcactatcccgatgctgatcaatattatgatgcacgtttcaggcgagcaaagc
catgcgctaggcgtaggcgatgaacaattgaatgataaaggattggcttggatcgtttta
caatacgaaatgaacattacgcaagttcctgagttttataaaaccattaaagtgaccacg
caagctatgtcttacaataaattgttttgttaccgtgattttaatgtatacgatgaagcc
ggcaatctatgtgttacagcgcacagcacatttgcactgctggatgttacgcagcggaaa
atggttcgtatccaagatgaagttgtcgcacctttcgaagcagagttttctaaaaagttg
attcgaacaccaaagcctgaaaaggtagcagatgaattgacggtatcaaatgaatatcgt
gtgcgttatttggacattgacagcaatcagcatgtgaataattctaaatacattgactgg
gcaatggacactttagattatgagtttttgactactcataaattaacctatctaaacatt
aaatttgaaaaagaagtttactatggcgataggatccaaagtcaaatgagcctgcatgaa
gcggaaaatggcaaaatcgtatcggctcatcgcattgtaacaggaagtacaaccaacagt
gaagctagtatggtctgggaaaaatcagaagatgaagtaagcaggtga

DBGET integrated database retrieval system