KEGG   Carnobacterium sp. CP1: NY10_1353Help
Entry
NY10_1353         CDS       T04230                                 

Definition
(GenBank) general stress protein A
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Motif
Other DBs
NCBI-ProteinID: ALV21961
UniProt: A0A0U3NN17
Position
complement(1411772..1412629)
Genome map
AA seq 285 aa AA seqDB search
MSRKRKIPIVSAADENYAPYLSVMMMSLLENLANDVEVTFYIIDDHISADSKEKLNQVVS
NQPATISYLEVDSDLYADVLESDHITQTAYYRISLPDLLADKHYEKVLYIDCDVLVQADI
SELYDTDIGDNVIGAVIDPGQALVLGRLGVETEDYYFNSGLMLMDLDNWRKANITEKTLT
FLQEEDEKIIYHDQDALNAIVYEKWFPLHPKWNLQTSLLFERHQPPTEQYAKWYKEAIQK
PSIIHFTGHDKPWNSEEYHPYTELYLEELAKSPFHLKETEKESTK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaaaaaggaaaattccaattgtgagtgccgcagatgaaaattatgcaccgtat
ctgagtgtaatgatgatgagtttgctcgaaaacttagcaaatgacgttgaagtgacgttt
tacattatcgatgaccatatctcggcggatagcaaagaaaagttgaaccaagtagtttcc
aatcaaccagctactattagctatttagaagtggattccgacttgtacgcagatgtgtta
gagagtgatcatattactcaaactgcttactaccgcatctctttacctgatttactagca
gataaacattatgaaaaagtcctttatatcgattgcgatgttttagtgcaagcagatatt
tcggaactatacgatacagacattggcgataacgtcattggcgccgttatcgatccagga
caagcacttgttttaggccggttaggagttgaaacagaagattattacttcaattcagga
ctgatgctaatggatttagacaattggcgaaaagcgaatattacagaaaaaacactaact
ttcttacaagaagaagatgaaaaaattatttatcatgaccaagatgcattgaacgcgatt
gtttatgagaaatggtttccgcttcatcctaaatggaacctccaaacgtctttattattc
gaaagacatcaaccgccaacagaacaatatgcgaaatggtacaaagaagccattcaaaag
ccctcaatcattcacttcactggccatgataaaccttggaattcagaggaatatcatcct
tacactgaactttacctagaagaattagcgaaatcaccgtttcatttaaaagaaactgag
aaagaatcaactaaataa

DBGET integrated database retrieval system