KEGG   Carnobacterium sp. CP1: NY10_1356Help
Entry
NY10_1356         CDS       T04230                                 

Definition
(GenBank) 4-hydroxybenzoyl-CoA thioesterase family active site
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NY10_1356
Enzymes [BR:carc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     NY10_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ALV21964
UniProt: A0A0U3NQY2
Position
1414940..1415374
Genome map
AA seq 144 aa AA seqDB search
MKKNLSQYEHKAQYYETYQMGIIHHSNYIRWFEEARTSLLDEVGFGYDQMEKEGIIVPVL
AISCDYTSMVRYNQTVLILPKVETFNGIRMTISYQITDKATGELKAAGKSNHCFLDKDYR
PISLKKANKKIYDLFEELIGKDLG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaacttatctcaatacgaacacaaagcacaatattatgaaacgtatcaaatg
ggcattattcaccactcaaattacattcgttggtttgaagaagcaagaaccagcttgctg
gatgaagtggggtttggctacgatcagatggaaaaagaaggcatcatcgttcctgtatta
gctatttcttgtgattacacatcaatggtgcgctacaaccaaacggtcttgatcttacca
aaagtagaaacctttaatggcatcagaatgaccatttcttatcaaatcaccgataaagca
actggcgaactaaaagctgctggaaaaagcaatcattgttttttagataaagattatcgt
cctatttcgttaaaaaaagctaataaaaaaatctatgacttatttgaagaacttattgga
aaagaccttggataa

DBGET integrated database retrieval system