KEGG   Carnobacterium sp. CP1: NY10_1366Help
Entry
NY10_1366         CDS       T04230                                 

Definition
(GenBank) Heme efflux system permease HrtB
  KO
K02004  putative ABC transport system permease protein
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:carc02000]
    NY10_1366
Transporters [BR:carc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    NY10_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX MacB_PCD
Motif
Other DBs
NCBI-ProteinID: ALV21973
UniProt: A0A0U3F786
Position
complement(1426861..1427985)
Genome map
AA seq 374 aa AA seqDB search
MFLALKELTYSKGRFMMISLIIMLIAWLVFILAGLGNGLSDLGAATLKYADVDYAVFEEK
SDFAFSKSMLPESLADDVMEEKGVEAVAPIGTASASVRKTGSEQSEAAKVDVLLAGIRPG
SFMEPKVTSGNALQADDPSGVIVDDSLKKDGFQIGDTLTISGSVEELTIVGFTKNQTLSH
QPVVFTSLEKFRMYKYAAPGSDNGIKDVVNSVMVQGKDVDPEKLEQSIDGIEVGTKKETI
NAVPGYTAENGTIMMMLGFLIVISAIVIAVFFYILTNQKAHQFGVMKAIGASNWFVIKSV
ISQVFILSLISILIGVGLTYATAAILPDSMPFNLEGQLVVTYSLILLLISVASSLFSVLK
IAKIDPLTALGRVE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagcattaaaagaattaacgtactcgaaaggtcggttcatgatgatcagtttg
atcatcatgttgattgcttggttagtatttattttagcgggcttaggcaacggattatca
gatttaggagcggccacattaaaatatgctgatgtggactatgctgtctttgaagaaaag
tctgattttgctttttctaaatcaatgctgcctgaatcattagcagatgacgtgatggaa
gaaaaaggagtagaagcggtcgctccaataggaacagcatctgcttcagtccgtaaaact
ggcagcgaacaatcagaagctgcaaaagtcgatgttttactggcaggcattcgcccaggt
tcttttatggaacctaaagttacttcaggtaatgcactacaagccgacgacccttcaggt
gtgatcgtagatgactctttgaaaaaagatggttttcaaataggcgataccttaaccatc
agcggctctgttgaagaactgactatcgtcgggtttactaaaaatcaaacgttgagtcat
cagcccgttgtttttacatcattagagaagttccgtatgtataaatatgctgctccaggt
tcggataacggcattaaagatgtcgtgaatagtgtgatggttcaagggaaagatgtcgat
cctgaaaaacttgaacaatcgatcgatggcattgaagttgggactaaaaaagaaaccatc
aatgcagtaccaggttatacagcagaaaatggaaccattatgatgatgttaggtttcttg
atcgtcatttcagcaattgtgattgccgttttcttctatatattaaccaatcaaaaagct
caccaatttggagtgatgaaagctatcggcgcaagcaactggtttgtgatcaaatctgtg
atttcgcaagtctttatcttatcattgatcagtatcttgattggcgtgggattgacttac
gcaacagcggctattttgcctgattccatgccctttaatttagaaggacaattggtcgtt
acgtatagtttgattttattgttgatcagtgtggccagttcgttgttttctgtattgaaa
attgccaaaattgacccactaacagctttagggagggtggaataa

DBGET integrated database retrieval system