KEGG   Carnobacterium sp. CP1: NY10_1367Help
Entry
NY10_1367         CDS       T04230                                 

Definition
(GenBank) hypothetical protein
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_10 TetR_C_4 DUF2431 DUF4318 HTH_Tnp_1_2 RRM_5 HTH_22 TetR_C_29 HTH_11
Motif
Other DBs
NCBI-ProteinID: ALV21974
UniProt: A0A0U3E7Q8
Position
complement(1428064..1428636)
Genome map
AA seq 190 aa AA seqDB search
MAREKKFSTEDIYQEAHSLLMAVGYDKFSFGLLANSLSVSRAAIYKYYTNKDELIYDYMI
SEMEKMVDDLEKLDWLTDYPAQFQQLFALIFEYGDVHQISFMIPNKQIADDEKMKEKKQR
SQLLHKRFFQQIQSFIQTGQTNGYIKKDIPKSIIIELIFHSVTIPDRVGLSQSERAYYLQ
EIICQGIFEK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctagagaaaagaaattttcaactgaagacatttatcaagaagctcattcgctttta
atggcggttggctatgataagttttcatttgggttattggcaaattcattgagcgtttcg
cgagccgctatctacaaatactatactaataaagacgaattgatttacgattatatgatt
tctgagatggagaaaatggtagacgatcttgagaaattggactggttaaccgattaccca
gcacagtttcagcaattattcgccttaatttttgagtatggggatgtccatcaaatttcg
tttatgattcccaataaacaaatagcagacgatgaaaagatgaaagaaaagaagcaacga
tcccaattgcttcataaacgtttttttcagcaaattcaatcatttatccaaacgggacaa
actaatgggtacattaaaaaagatattccgaaaagtatcattattgaacttattttccat
agcgtaacaatccctgatcgtgtggggttatcacaatcagaaagggcctattatctgcaa
gaaatcatttgccaaggaatctttgaaaaataa

DBGET integrated database retrieval system