KEGG   Carnobacterium sp. CP1: NY10_1369Help
Entry
NY10_1369         CDS       T04230                                 

Definition
(GenBank) Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase
  KO
K04047  starvation-inducible DNA-binding protein
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:carc03036]
    NY10_1369
Chromosome and associated proteins [BR:carc03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    NY10_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin
Motif
Other DBs
NCBI-ProteinID: ALV21976
UniProt: A0A0U3DRW0
Position
complement(1430144..1430617)
Genome map
AA seq 157 aa AA seqDB search
MAQTNTEVQGLLNDMVASHGVFITKLYQHHFYVQGPHFFTLHIKFEELYKETTEHFDELA
ERLIAIGGKPYATLKEFLEHSAIEEKPYTEKVSAEEMVASTVADYRILCDNLEAGIKLTG
EAGDDVTQDLLIAYKTGVDKNIWMLQAFLGKDPLEGK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacgaacactgaagtacaaggattgttaaacgatatggtagcatctcatggg
gtgtttattacgaaactgtatcaacatcatttttatgtacaaggacctcacttctttacg
cttcatataaaatttgaagaactttataaagaaacaactgaacactttgatgaattagca
gaacgcttgattgcgatcggcggcaaaccttacgctacgttaaaagaatttttagaacac
tctgctattgaagaaaaaccgtatacagaaaaagtatctgcagaagaaatggtggcttct
acagtagccgattaccgcattctttgcgataatttagaagctggtatcaaattgactggc
gaagccggagacgatgtcacacaagacttattgattgcttacaaaacaggcgtcgataaa
aatatctggatgctccaagctttccttggcaaagacccattagaaggcaaataa

DBGET integrated database retrieval system