KEGG   Carnobacterium sp. CP1: NY10_1375Help
Entry
NY10_1375         CDS       T04230                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00071  Fatty acid degradation
carc00072  Synthesis and degradation of ketone bodies
carc00280  Valine, leucine and isoleucine degradation
carc00310  Lysine degradation
carc00362  Benzoate degradation
carc00380  Tryptophan metabolism
carc00620  Pyruvate metabolism
carc00630  Glyoxylate and dicarboxylate metabolism
carc00640  Propanoate metabolism
carc00650  Butanoate metabolism
carc00900  Terpenoid backbone biosynthesis
carc01100  Metabolic pathways
carc01110  Biosynthesis of secondary metabolites
carc01120  Microbial metabolism in diverse environments
carc01130  Biosynthesis of antibiotics
carc01200  Carbon metabolism
carc01212  Fatty acid metabolism
carc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NY10_1375
   00630 Glyoxylate and dicarboxylate metabolism
    NY10_1375
   00640 Propanoate metabolism
    NY10_1375
   00650 Butanoate metabolism
    NY10_1375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NY10_1375
   00072 Synthesis and degradation of ketone bodies
    NY10_1375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NY10_1375
   00310 Lysine degradation
    NY10_1375
   00380 Tryptophan metabolism
    NY10_1375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NY10_1375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NY10_1375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY10_1375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:carc04147]
    NY10_1375
Enzymes [BR:carc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NY10_1375
Exosome [BR:carc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NY10_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2802
Motif
Other DBs
NCBI-ProteinID: ALV21982
UniProt: A0A0U3MD83
Position
1436430..1437611
Genome map
AA seq 393 aa AA seqDB search
MEEVVIVSAARTPIGKFGGSLKNTTAVELGILVAKQAIDRAAISPEVVNQVIFGNVLQAG
LGQNPARQIAVHADVPYASPAMTINEVCGSGLKSVILASQAIQLGDADVIVAGGTENMSQ
APYLLNHHRWGKKAGDDRMIDSAMHDGLSDAFNHLPMGLTAEKVAEQYGISRAEQDAFAL
RSQMKAAAAQENGRFTEEIVPVAVKDSKGKPLLFSEDEFVRKNTSLESLTALNPAFAENG
TVTAGNSSGINDGAAALVLMKKSRAEQLGVPYLATIRGYAEIGIDPSIMGYAPYQAIETV
LKKTNLSLDDIDLIELNEAFAAQSVAVSRDLKLHSDKVNVNGGAIALGHPIGASGARILV
SLLHEMQKKQAHLGLASLCVGGGIGISMVLEKS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtcattgttagtgccgcaagaacaccaattggaaaatttggcggaagc
ttaaaaaacacaaccgctgttgaattaggtattctcgtcgcgaaacaagccattgatcgg
gcagctatttcaccagaagtagtaaatcaggttatttttggaaatgtcttacaagctgga
ctaggacaaaacccagcacgtcaaatagctgtccatgccgatgttccttatgcatcccca
gcgatgaccattaatgaagtttgcggttcagggttaaaatccgtcattcttgccagtcaa
gccattcaattaggagacgctgatgtgatcgtagcaggcggaacagaaaacatgtcacaa
gctccttatcttttaaatcatcatcggtggggaaaaaaagctggcgatgaccggatgatc
gacagcgctatgcatgatggtttatcggatgcgttcaatcatctgcctatgggtctgacc
gctgaaaaagtagcggaacaatacggcatttcaagagccgaacaagatgcattcgcgtta
cgctcgcaaatgaaagctgcagctgcacaggagaatgggcgattcacggaagaaatcgtc
ccagttgcggttaaagattcaaaaggcaaaccgcttttattcagtgaagacgaatttgtt
cgaaagaatactagtttagaaagtttaactgctcttaaccctgcttttgccgaaaacgga
accgttactgccggaaattcttcgggtataaacgatggagcagcagcacttgtcttgatg
aaaaaatcccgtgctgaacaattaggtgtgccttatttagccaccatacgcggatatgct
gaaatcggcattgacccttcgatcatgggatatgctccctatcaggccattgaaacggtt
ttaaaaaaaacaaacttgtctttggatgatattgacttaattgaattaaatgaagctttt
gctgctcaaagtgtagccgtatctagagatttaaagcttcatagcgacaaagtcaacgtg
aatggcggagcgatcgctttaggccatccgataggcgcttccggagccagaattttagtc
agtttgctccacgaaatgcaaaaaaaacaagctcatttaggattagcttcattatgtgta
ggcggcggaatcggaatttctatggtacttgagaagagctaa

DBGET integrated database retrieval system