KEGG   Carnobacterium sp. CP1: NY10_1376Help
Entry
NY10_1376         CDS       T04230                                 

Definition
(GenBank) LSU ribosomal protein L25p
  KO
K02897  large subunit ribosomal protein L25
Organism
carc  Carnobacterium sp. CP1
Pathway
carc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:carc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NY10_1376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:carc03011]
    NY10_1376
Ribosome [BR:carc03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    NY10_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Motif
Other DBs
NCBI-ProteinID: ALV21983
UniProt: A0A0U3MN83
Position
1437785..1438390
Genome map
AA seq 201 aa AA seqDB search
MKINAELRTEVGTSSANRYRRENKIPAVVYNKGSETTPVLLDSKDFDKVLKELGKNGIFD
IVTAEGESKQVIIKDFQSAALKYQILDVELQAITKDQKLTVTVPIILSGAEGVKEGLVSQ
TLNELEIETTPANIPTEFTADVSALTIGDSLTVADLSVDKEITVFNEQDETVAIVAPPTV
MEEPAEPAEASDPEVIGEKEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatgcagaattgagaactgaagttgggacttcttcagctaatcgttacaga
cgggaaaataaaatcccggcagttgtttataataaaggatccgaaactactcctgtcttg
ttagacagcaaagattttgacaaggttttaaaagaattaggtaaaaacgggatttttgat
atcgtaactgcagagggagaatcaaaacaagttatcattaaagatttccaaagcgctgct
ttaaaatatcaaattttggatgtagagcttcaggctattacaaaagaccaaaaactgaca
gtgacagttccgatcattttatcaggtgctgaaggcgtcaaagaaggtttagtttcacaa
accttaaatgaactagaaattgaaacaacaccggctaatattccaactgaatttaccgct
gatgttagtgctttaaccattggagactctttaacagtagcagacttgtctgttgataaa
gaaattactgtctttaatgaacaagacgaaacagtggctattgtagcaccgccaactgta
atggaagagcctgctgaaccagctgaggcaagcgaccctgaagttattggagaaaaagaa
gcttaa

DBGET integrated database retrieval system