KEGG   Carnobacterium sp. CP1: NY10_1385Help
Entry
NY10_1385         CDS       T04230                                 

Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3-dmu-9_3-mt DUF2597
Motif
Other DBs
NCBI-ProteinID: ALV21990
UniProt: A0A0U3E7S2
Position
complement(1443409..1443873)
Genome map
AA seq 154 aa AA seqDB search
MQKIITHLWFDNEAQEAVDLYTSIFADSKILTTEHLNAPGEGNEGSVMAIEFQLAGQEFI
AINGGPYFTFTPAMSLYINCETQLEVDTIWDTLVLEGEPGECGWLTDKYGISWQVVPTVL
RKLLTDADPVKRDAVSTAMFKMKKTRDNRITKSL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatcatcactcatttgtggtttgataatgaagcacaagaagccgttgatttg
tacaccagtatttttgcagattcaaaaattttaacgaccgagcatctaaacgctcccggc
gaaggaaatgaaggaagtgtcatggcaattgaatttcagttagcaggacaagagttcatc
gccattaatggaggtccttatttcacatttaccccagcaatgtcactgtatattaactgt
gagacccaattagaagttgataccatctgggatactttagtattagaaggcgagccggga
gaatgcggttggctaaccgataaatacggtatttcttggcaagttgttcctactgtatta
agaaaacttttaacagatgctgatccggtcaaacgggatgctgtttcaactgctatgttc
aaaatgaaaaaaactagagataacagaattacaaaaagcttatga

DBGET integrated database retrieval system