KEGG   Carnobacterium sp. CP1: NY10_1394Help
Entry
NY10_1394         CDS       T04230                                 

Definition
(GenBank) Potassium voltage-gated channel subfamily KQT potassium channel, VIC
  KO
K10716  voltage-gated potassium channel
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:carc02000]
    NY10_1394
Transporters [BR:carc02000]
 Other transporters
  Pores ion channels [TC:1]
   NY10_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans Ion_trans_2 zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: ALV21999
UniProt: A0A0U3MN92
Position
1451563..1452357
Genome map
AA seq 264 aa AA seqDB search
MKKKRIFEIIQIGRDTDILSRIFDFTIVTAISANLVLTIYSTFDSSIDYAGIIHTVEMAT
VILFTIEYGLRIWTANYLYPNTSKSRAIFKYAFSFTGLVDFLSFFPFYLPFFFPDGAVAF
RIFRVVRILRLFRINQYYDSLNVITDVLKNKKQQLISSVFIIFVLMTAASLVMYNFEHAA
QPDVFTNAFSGFWWAASSLLTVGYGDIYPITLAGKLFGIVITFLGVGMVAIPTGILSAGF
VEQLTTVQEPNSIQYCPHCGKKLL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaaggatttttgaaattattcaaattgggcgcgatacggatattttaagc
agaatatttgattttacgatcgttacagccatttcagcaaacttagtcctcactatttat
tctactttcgatagttccatagattatgctggtatcattcatacggttgaaatggcaacg
gttatactgtttaccattgagtatggactaagaatatggacggctaactatctttatcca
aatacttcaaaaagcagagctatcttcaagtatgccttttcttttacaggtcttgttgat
tttttatcttttttccctttttacctgccgttctttttcccagatggcgctgtagccttt
cggatattccgagtcgtccgaattttacgactatttcgaatcaaccaatactatgattcg
ctcaatgttattacagatgtccttaaaaataaaaaacaacaattgatttcatctgttttt
attatttttgttttaatgaccgctgcttcattagtgatgtataactttgaacatgcagcc
cagccggatgtattcactaacgctttttcaggcttttggtgggctgcctcttcattgctg
acagttggatatggagatatctatccgatcactttagccggaaaattatttggcattgtt
attacttttttaggagtaggaatggttgctattcccactggtattttgtctgctggattt
gttgagcagcttaccactgtgcaggaaccaaactccatccagtattgtcctcattgcgga
aaaaaattactgtaa

DBGET integrated database retrieval system