KEGG   Carnobacterium sp. CP1: NY10_1405Help
Entry
NY10_1405         CDS       T04230                                 

Definition
(GenBank) SAM-dependent methyltransferase YrrT
  KO
K17462  putative AdoMet-dependent methyltransferase [EC:2.1.1.-]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00270  Cysteine and methionine metabolism
carc01100  Metabolic pathways
carc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NY10_1405
Enzymes [BR:carc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     NY10_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_31 Methyltransf_12 DREV CMAS Methyltransf_PK RrnaAD Methyltransf_2 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ALV22010
UniProt: A0A0U3NZK6
Position
complement(1461757..1462398)
Genome map
AA seq 213 aa AA seqDB search
MGREFLEIFSDWSEDYDEFVEGKDPEYQEVFKNYDRILNELVSRSGNSIIEFGIGTGNLT
LKLLAAGKTVFPIEPSREMREAAQKKLPTELEIIDGDLQKYPKPDRAIDTMVSSYVFHHL
TDKEKALVLKDYALQLEENGKVVFADTMFKSKAAFFQKLNEAKKQNFYRLAEDLEREYYP
IVSTVEQLFEEAGFDVDVQQMNDYVWIVTGTKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagaatttttagaaattttttcagactggtcagaagattatgatgagtttgtt
gaaggaaaagacccagagtaccaggaagtctttaaaaattatgataggatattaaatgag
cttgtttcaagaagcgggaacagcatcatagagtttggaatcggtacaggaaatttaacg
ctcaaattgctagcagcaggaaaaacggtttttcccattgagccttctagggaaatgcgg
gaagcagctcaaaaaaaactgccaaccgaacttgaaattatagatggcgatttgcagaag
tatccaaaacctgacagagcaatagatacaatggttagttcctatgtcttccatcatttg
acagataaagaaaaggctctagtactaaaggattacgctctccaattggaagagaatgga
aaagtcgtttttgctgatacgatgtttaaatccaaagcagcattttttcaaaagcttaac
gaagccaagaaacagaacttttatcgattagctgaagatttggagcgtgagtattatcct
attgtttcgacggtggagcagctttttgaagaagccggttttgatgtggatgttcagcaa
atgaatgattacgtctggatagtgactggaaccaaaaaataa

DBGET integrated database retrieval system