KEGG   Carnobacterium sp. CP1: NY10_1408Help
Entry
NY10_1408         CDS       T04230                                 

Definition
(GenBank) Thioredoxin
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin TraF HyaE Phosducin Thioredoxin_2 DUF836
Motif
Other DBs
NCBI-ProteinID: ALV22013
UniProt: A0A0U3NLE5
Position
complement(1465020..1465358)
Genome map
AA seq 112 aa AA seqDB search
MNTFPQATSINEVRNFIDENPLAFVYISRENCGVCHAVQPQVQEMLVEFPMIKPIQVNAD
KVPEIASEFTVFTVPALLLFADNKEVVREARFVVTDNLHDQFQRVVENYEQL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttttcctcaagcaacctctattaacgaggtcagaaacttcattgatgaaaac
ccattggcatttgtatacatttcaagagagaattgcggcgtttgtcatgccgttcaacct
caagttcaagaaatgttagtagaatttcctatgatcaaacccattcaagtaaatgcagat
aaagttcctgaaattgcaagtgaattcacagtatttactgttcctgctttgcttttgttt
gctgataataaagaagttgtccgagaagcgcgttttgtcgttacggataatctgcatgat
caattccagcgcgtcgttgaaaattatgagcaactgtaa

DBGET integrated database retrieval system