KEGG   Carnobacterium sp. CP1: NY10_1420Help
Entry
NY10_1420         CDS       T04230                                 

Definition
(GenBank) Flagellar basal-body rod protein FlgF
  KO
K02392  flagellar basal-body rod protein FlgG
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:carc00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    NY10_1420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1420
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    NY10_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod
Motif
Other DBs
NCBI-ProteinID: ALV22025
UniProt: A0A0U3NN92
Position
complement(1477440..1478198)
Genome map
AA seq 252 aa AA seqDB search
MIRSIDTLSRNFDILQKKQENISANVANINTAGYKSQELIQSTLASKPMVNHLGGPLLNQ
QNDIGSFTFGNQIDEVYTNFEQGGLKGTASITDIALQSDGFFTIAGDDGQTYYTRNGNFT
ANADGELVTQEGHHVMGIDAGGQPTFIPAGGMDFSVDSTGNINGTGLRLLVTEFNDPSTL
TSVGDTLYTGQGGTAMNGGVTIYQSMVETSNVKTADEITNLMMVSREFGANQKMLNAADE
TLKKSVNEIGRV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagtatagatacgcttagccgaaattttgatattctacaaaaaaagcaagaa
aacattagcgccaatgtagctaatatcaatacagcaggatataaatcacaagaactcatt
caaagtacacttgcttctaaaccaatggtcaatcatttgggcggaccgttattaaaccaa
caaaatgacatcggttcatttactttcggcaaccaaattgacgaagtctacacaaacttt
gagcaaggcgggctgaaaggaacggcttcgattacagatattgccttgcaaagcgatggt
tttttcacaatagctggagatgatggtcagacttattacacgagaaatggcaactttacg
gctaatgctgatggagaactggtaactcaagaaggacatcatgttatgggaattgatgct
ggcggacagccgacttttattccggctggcggaatggatttctctgtggacagcactggg
aatattaatggaaccggcttgcgtttgctagtgactgaatttaacgatccgtctactttg
accagtgtcggggacacattgtatacaggacaaggcggaacagcaatgaatggcggagtg
accatttatcaaagcatggttgaaacatcaaatgttaaaacagccgatgaaatcacgaac
ttgatgatggtttccagagaattcggagcgaatcaaaaaatgctgaacgctgcggatgaa
acattgaaaaaatcggttaacgagatcggaagagtctag

DBGET integrated database retrieval system