KEGG   Carnobacterium sp. CP1: NY10_1428Help
Entry
NY10_1428         CDS       T04230                                 

Definition
(GenBank) hypothetical protein
  KO
K02415  flagellar FliL protein
Organism
carc  Carnobacterium sp. CP1
Brite
KEGG Orthology (KO) [BR:carc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1428
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    NY10_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliL Cas_Csa4
Motif
Other DBs
NCBI-ProteinID: ALV22033
UniProt: A0A0U2VKW7
Position
complement(1484361..1484828)
Genome map
AA seq 155 aa AA seqDB search
MEVQSTKDKEKKKWLKPLIIIVSALIIGGIVSFSITSGKVQAFVQRLGEEEKIETTVPLE
EFLVNLSPGETGKGQYLKIELSVYSLEEDAQELIDKNIPQIRDAVISVLRTKTSDTVFQE
EEGSLVLKKELISQINETLGNAVIRDVFITNIIMQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaatcgacaaaagataaagaaaaaaagaagtggttgaagccgttgattatc
attgttagtgcacttattatcggaggaatcgttagttttagtataacttctggaaaggtt
caagcatttgtacagcgtttaggagaagaagagaaaatagaaacgactgttccgctggaa
gagtttttagtaaacttatccccaggagagacaggaaaaggacaatacttaaaaatagaa
ttatcggtttacagtcttgaagaagatgcgcaagaactgatcgataagaacataccccag
atacgagatgctgttattagtgttttacgtacaaaaacgagcgacactgtttttcaagaa
gaggaaggttcattggttctgaaaaaggaattgatcagccaaatcaatgaaacactgggg
aacgcagtaattagggatgtatttattacaaatatcatcatgcaatag

DBGET integrated database retrieval system