KEGG   Carnobacterium sp. CP1: NY10_1430Help
Entry
NY10_1430         CDS       T04230                                 

Definition
(GenBank) Flagellar motor rotation protein MotA
  KO
K02556  chemotaxis protein MotA
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02020  Two-component system
carc02030  Bacterial chemotaxis
carc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:carc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY10_1430
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NY10_1430
   02040 Flagellar assembly
    NY10_1430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:carc02000]
    NY10_1430
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1430
Transporters [BR:carc02000]
 Other transporters
  Pores ion channels [TC:1]
   NY10_1430
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    NY10_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB DUF4149
Motif
Other DBs
NCBI-ProteinID: ALV22035
UniProt: A0A0U3P339
Position
complement(1485556..1486356)
Genome map
AA seq 266 aa AA seqDB search
MKKNIVPLAGFILGLALIVWSITSAGELNSFLDAPSLVITLGGSFSALIISFPLKSLLKI
PSILKNLLLNPNSNYEELIETFVNLSKKARSQGILSIEEDLQEEDNELLVTGLQMVIDGM
DPETIQEILDIKTENIEKRHRVGQDIFLKWGELAPAYGMIGTLIGLIIMLGELNDPNTIG
TGMATALITTLYGSFLANLVFLPIATNLQMQTDEEMQVCEMVIEGVLSIQAGQNPRIIEQ
KLKSYLRDENQEEAVREAEQLQREEQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatattgtaccattggccggttttatcttagggttggctctgatcgtctgg
tcaattacttcagcgggtgaattaaatagttttctggatgctccttcgctggtaattacc
ttaggaggttcttttagtgcattgatcatcagttttcctttaaaatctttgctgaagata
ccgtcgattcttaaaaatttattattgaaccctaatagcaattatgaagaattgattgag
acgttcgttaatttgtctaaaaaagccagaagccaaggaatcttatccattgaagaggat
ttacaggaagaagacaatgagttattagtgacaggtttgcaaatggtgatcgatggaatg
gacccagagactattcaagagatattagatataaaaacagaaaatattgaaaaaagacat
cgtgtcggacaagatatttttttgaagtggggagaattagcaccagcgtacgggatgatc
ggaacattgatcggattgattattatgttaggtgagttaaatgacccaaatacaattggc
acaggtatggccacggctttgatcacaaccctttatggtagttttttagcaaacttagtt
ttccttccaatagctaccaatttacaaatgcaaaccgatgaagagatgcaagtgtgtgaa
atggttattgaaggtgtgctttctatccaagccggtcagaatccgcgtattattgagcaa
aaattaaaaagctatttacgcgatgaaaatcaagaagaagctgtaagagaagccgaacaa
cttcaacgtgaggagcaatag

DBGET integrated database retrieval system