KEGG   Carnobacterium sp. CP1: NY10_1433Help
Entry
NY10_1433         CDS       T04230                                 

Definition
(GenBank) flagellar hook associated protein
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellar_put DUF4258
Motif
Other DBs
NCBI-ProteinID: ALV22038
UniProt: A0A0U3E7X0
Position
complement(1487603..1487983)
Genome map
AA seq 126 aa AA seqDB search
MSFKVTPNQTQPSEIKPAAIRPKVDRRFSSFLSESIEKPLGQKEVKISNHAQKRLEERGL
QLDQQDMHQLEAAVEELSGKGSKNSLIFYKDMALITSVPNRTIITALNTQEMDMVTNIDS
AMRINQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttaaagtaactcccaatcaaactcaaccgtcagaaataaagccagcagcgata
cgtccaaaagtagaccggcgattcagttcatttttaagcgaatcaattgagaaaccgctt
ggtcaaaaagaggtcaaaatttctaatcatgcacaaaaacgactggaagaacgcggactt
caattggaccagcaagatatgcatcaattagaagcagcggttgaagaattgagtggaaaa
ggctcaaagaactcgttgattttttataaagatatggcactcatcaccagtgtccctaac
cgtacgatcatcacggcgttaaatacacaagaaatggatatggtcaccaatattgacagt
gctatgcgcatcaatcaataa

DBGET integrated database retrieval system