KEGG   Carnobacterium sp. CP1: NY10_1454Help
Entry
NY10_1454         CDS       T04230                                 

Definition
(GenBank) hypothetical protein
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02020  Two-component system
carc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:carc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY10_1454
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    NY10_1454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1454
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    NY10_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM
Motif
Other DBs
NCBI-ProteinID: ALV22059
UniProt: A0A0U3PCI0
Position
complement(1504445..1504732)
Genome map
AA seq 95 aa AA seqDB search
MKIENGYNQYMNAVRQNKDHAQSRGLSPKIEPTEKEESVQVTISDAAKKLSQAKTTETRQ
ADIEVIKKSVLDGTYSVSPEKIAKNMITAMNAQRK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaaaatggctacaaccaatatatgaacgctgtccgccaaaataaggatcat
gcccaatctagaggtttgtccccaaaaattgaaccaacagaaaaagaagagtcggttcaa
gtcactatttcagatgcagccaaaaaactgtcacaagccaaaacaaccgaaactcgtcaa
gcagacatagaagtgatcaaaaaatcagttttagatggaacgtattctgtttcccctgaa
aaaatcgctaaaaatatgataactgccatgaatgcacaaagaaagtag

DBGET integrated database retrieval system