KEGG   Carnobacterium sp. CP1: NY10_1455Help
Entry
NY10_1455         CDS       T04230                                 

Definition
(GenBank) Flagellar motor switch protein FliN
  KO
K02417  flagellar motor switch protein FliN/FliY
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02030  Bacterial chemotaxis
carc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:carc00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NY10_1455
   02040 Flagellar assembly
    NY10_1455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:carc02044]
    NY10_1455
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1455
Secretion system [BR:carc02044]
 Type III secretion system
  Flagellar export apparatus
   NY10_1455
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    NY10_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheC FliMN_C CheX FliM
Motif
Other DBs
NCBI-ProteinID: ALV22060
UniProt: A0A0U3NR70
Position
complement(1505584..1506630)
Genome map
AA seq 348 aa AA seqDB search
MSNEMLSQEEIDAMLNAPTETTADTIDKDQQDIIGEVGNITMSQAATTLSSILNHRVTIT
TPRVTCLKFQEIIDESKAPKVVTTIEFKQGLVGSNLLMMDINDAIIIADLMMDGDGDATG
KEFTELELSAVGEAMNQMIGSSSTAMATMLERTVDILPPDVEVWKDNETVQYDKIKGDTV
VCKIAFKMTVDDLIESEIMQIFTLDTVRDIAAIMMSSDAEVLEERQLPAEPAPVPTTPET
SEKVGIQTPEFQELTSTGTLTNARNLDLIMDVPLHFSVVLGENQKTIKDILALGAGSVVE
LDKMTDEPLQIFVNNKLIAEGEVVVINESFGVRITNILSQEQRIKKLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaaatgctatcccaagaggaaatagatgcaatgttaaatgcacccactgaa
acaacagctgatacaattgataaagaccaacaagatatcattggtgaagttggcaatata
actatgtcccaagctgcaacaacactgtcttccattcttaaccatcgggtaacgatcaca
actccacgtgtcacttgtctaaaatttcaagaaatcattgatgaaagcaaagcacctaaa
gtggttacaacgattgaatttaaacaagggttggttggcagcaatttgttgatgatggac
ataaacgatgcgatcatcattgctgatttaatgatggacggcgatggcgacgcaaccggt
aaagaatttactgaattggaactgagtgccgttggagaagcgatgaatcaaatgatcggt
tcttcttcaacagcgatggcaaccatgctggaacggacagttgatattttgccgcctgat
gttgaggtctggaaagataatgaaactgtacaatatgacaaaatcaaaggcgatacagtt
gtttgtaaaattgcttttaaaatgactgtcgatgacctcattgagagtgaaatcatgcag
atcttcacattggataccgtccgggatattgctgcaatcatgatgagcagcgatgctgaa
gtgttggaagaaagacaattaccggctgagccggcacctgttccaactacaccggaaaca
tcagaaaaagtagggattcaaacgcctgaattccaagaactgacgagtaccggtacactg
accaatgctcgtaatttggatttaatcatggatgttccgcttcacttcagtgttgtctta
ggggaaaaccaaaagacgatcaaagatatcttggcactaggggctggatctgttgttgaa
ttggataaaatgaccgacgaaccgttacaaatttttgtcaataataaactgattgccgaa
ggagaagtcgttgtcatcaacgaaagcttcggagtccgcatcaccaatattctaagccaa
gaacaaagaatcaaaaagttaaaataa

DBGET integrated database retrieval system