KEGG   Carnobacterium sp. CP1: NY10_1456Help
Entry
NY10_1456         CDS       T04230                                 

Definition
(GenBank) Flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02030  Bacterial chemotaxis
carc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:carc00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NY10_1456
   02040 Flagellar assembly
    NY10_1456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1456
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    NY10_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliM FliMN_C DUF4065
Motif
Other DBs
NCBI-ProteinID: ALV22061
UniProt: A0A0U3NLJ7
Position
complement(1506630..1507628)
Genome map
AA seq 332 aa AA seqDB search
MKQVLSQQEIDSLLKAVESGEIDAKGLEEQEKEQNKVKNYDFKRPARLSKEYISTLNMVF
EEFAKIVGNKLSTQVRTNVELQLASIEQVSFDEFVHSVPRFTLMGMFHSRPLEGTQIVEL
SPQLCLQLIDLLCGSAEVRTTGEEVVKENFTDIEKAILDDILVDFIRAFELAWRDVVELD
VQLETTETNPQLLQNMSPNEPVVLVTFTVELFGVRTFANICVPYIFFETILDKLSLKNWF
HTEKGTDHSDSKRIEASLNSAKVNLEVLLGEATMTLENFLQLELGDIIPLEGKTSDPLIM
SVEQRPHYLVKPGLKGKKRAIEVLQYIEGETD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaagttttatcacaacaagaaattgattctttactgaaagcggtagaaagcgga
gaaattgacgcaaaaggtttagaagaacaggaaaaagaacaaaacaaagttaaaaactat
gattttaaacgtcctgcccgtttgtctaaagaatatatcagtacattaaatatggtgttt
gaagaatttgcaaaaattgttggaaacaagttatcaactcaagtcagaaccaatgttgag
ttgcagctggcgtctattgaacaagtcagttttgatgaatttgtgcattcggttcctcgt
tttactttaatgggcatgtttcattctagaccattagaagggacgcagatcgtcgaactg
agcccgcagctttgtctgcagctgatcgacttgttatgcggaagtgctgaagtgagaacg
actggcgaagaagtagtgaaagaaaacttcacggatattgaaaaagcgattttagatgat
attctagttgattttattcgtgcatttgaattagcttggcgcgatgttgtcgaactggat
gtacaattagaaacaacggaaacaaatccgcagctgctgcaaaatatgtcacctaacgaa
ccggttgttttagtgacctttaccgttgaattattcggcgtgcggacatttgctaatata
tgtgttccttacatattctttgaaacgattttagataaactaagcttaaagaactggttc
cacactgaaaaaggaacagatcattctgacagcaaaagaatagaagccagtttaaattct
gccaaagtaaacttagaagttcttttaggagaagctacgatgacattggaaaacttcctt
caactggaactaggcgatattattcctctagaagggaaaacttcagatccgctgattatg
tcagtagaacaacgtccgcactatctcgtgaaaccgggattaaaaggcaaaaagagggcg
attgaagtattacagtatattgaaggagagacagactga

DBGET integrated database retrieval system