KEGG   Carnobacterium sp. CP1: NY10_1457Help
Entry
NY10_1457         CDS       T04230                                 

Definition
(GenBank) Positive regulator of CheA protein activity
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02020  Two-component system
carc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:carc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY10_1457
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NY10_1457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1457
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NY10_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW
Motif
Other DBs
NCBI-ProteinID: ALV22062
UniProt: A0A0U3MDF0
Position
complement(1507631..1508047)
Genome map
AA seq 138 aa AA seqDB search
MMQIIIFTLNKKYYAFSSESVEEITKKMPWTAIPQSPKWVQGLINLRGNVITLINFYELL
FPTDVSEELCYNNIIIVKKDEEKLAFMVDNVAWVTEIDPADIQELEHQAEDKVSGLIQVK
DQIVNIINMETLFYKNEG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaataattattttcacactaaataagaagtattatgctttttcttctgaaagt
gtagaagaaataaccaaaaagatgccttggacggctatcccgcaatctccaaaatgggtt
caaggattgatcaatttaagaggaaacgtcattaccctgataaatttttatgaactgctc
ttccctactgatgtatctgaagaattatgttacaataacatcatcattgtgaaaaaagat
gaagaaaaacttgcattcatggtggataatgttgcatgggttacggaaatagacccagca
gatattcaagagcttgagcaccaagctgaagataaagtatccggattgattcaagtgaaa
gatcagatagtgaatataatcaatatggagacactattttataaaaatgagggatag

DBGET integrated database retrieval system