KEGG   Carnobacterium sp. CP1: NY10_1462Help
Entry
NY10_1462         CDS       T04230                                 

Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc02020  Two-component system
carc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:carc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY10_1462
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NY10_1462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:carc02022]
    NY10_1462
   02035 Bacterial motility proteins [BR:carc02035]
    NY10_1462
Enzymes [BR:carc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NY10_1462
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     NY10_1462
Two-component system [BR:carc02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   NY10_1462
Bacterial motility proteins [BR:carc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NY10_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Cellulase-like
Motif
Other DBs
NCBI-ProteinID: ALV22067
UniProt: A0A0U3P374
Position
complement(1511942..1512970)
Genome map
AA seq 342 aa AA seqDB search
MGIKVLVVDDSAFMRKIITETISEIAGLEIVGTARNGRDALKAIPALKPDIVTLDIEMPG
LNGLETLEIIKQEFHIPVVMMSSHSGEDNTIEALELGAMDFIEKPVDLKNQIEEFKKEIE
RKIKPLFETKEVAGLLKPLAKKAAQKEWQQAVPKKVKAIVIGASTGGPKALLHVVRNLPE
SLDIPVFIVQHMPKGFTASFAERLDMKSTVTVVEAQEGMQIQNGVVYLAPGDYHMTIEQN
KIKLDSSPKILGVRPAVDYLFQSAAAVYEEALVSVILTGMGHDGSAGMSEIKRKGGFTLA
QDRETSVVYGMPGNAVKKGVVDEVASLTEISEMINWIVRVRQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggggatcaaagtgttggtcgtggatgattctgcattcatgagaaaaataataacagag
acgatatcggaaatagcaggactggaaattgtcggaactgcaagaaatggccgggatgct
ttaaaagctattccagcacttaaaccagatatcgtgacgttagatatcgaaatgccaggt
ttaaatggactggaaacacttgaaatcattaaacaggaatttcatattccagttgtgatg
atgagctctcatagcggagaagataataccatcgaagctttagaattaggggcaatggat
tttatcgaaaaaccggttgatttgaaaaatcaaatagaagaatttaaaaaagaaatcgaa
agaaaaatcaaaccactgtttgaaacaaaagaagtagcaggtctgctaaagccgcttgct
aaaaaagcggcacaaaaagaatggcagcaggccgttccgaaaaaagtgaaagctattgtg
atcggcgcttctactgggggaccaaaagccttattgcatgttgtgcgcaatttgccagaa
agcttggatattcctgtttttatcgttcagcacatgcctaaaggttttacagcttctttt
gctgaacggttggatatgaaatcaacggtaaccgttgttgaagcacaagaaggtatgcag
attcaaaatggagtcgtctatttggctccgggtgattatcatatgacgattgaacaaaat
aagatcaaactggatagttcgccaaaaattttaggtgtaaggccggcagtcgattatttg
tttcaatcggcagctgctgtttatgaagaggcgttagtgagtgttattttgactggaatg
gggcatgatggaagtgccggaatgagtgaaatcaaaagaaaaggcggttttacactggct
caagaccgcgaaacatctgtcgtctacggaatgccgggcaatgcagtgaaaaaaggtgtt
gtagatgaagttgccagcttaacagagatatctgaaatgataaattggatagtaagggtg
agacaatga

DBGET integrated database retrieval system