KEGG   Carnobacterium sp. CP1: NY10_1466Help
Entry
NY10_1466         CDS       T04230                                 

Definition
(GenBank) oxidoreductase of aldo/keto reductase family, subgroup 1
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: ALV22071
UniProt: A0A0U3MXG5
Position
1516566..1517408
Genome map
AA seq 280 aa AA seqDB search
MDKNVPEITLNDGLIMPNIGFGTYTIKGARGVNAIENAIAAGYRLIDTAYNYENEATVGQ
AIKRSSVPREKLVVTSKLPGRYHLYDDAVTAIQESLYRAGLDYYDLYLIHWPNPKQDQYI
EAWQALIDAQKFGLIRSIGVSNFLPEHLKRLEKETDVLPSINQIELHPYFTQEKQLAWNK
EQGIQTQSWSPLGRANDILQNKAIKEIADTHKKSISQTILRWHIQLGSIPIPKSSSFKHQ
LDNLSIFDFVLTDEEMTLISALNKPDGRNKNQDPAEYEEF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgttccagaaatcacattgaacgatggattaattatgcccaatattggc
tttggtacgtatactataaaaggagcacgtggagttaatgctattgaaaatgccattgct
gcgggttaccgtttaatcgataccgcctataattacgaaaacgaagcaaccgttggacaa
gccatcaagcgcagttctgttccccgcgaaaaattagtggtaacctcaaaacttcctggt
cgttaccacctgtatgatgatgccgtcactgctatccaagaatccctttaccgggcaggg
cttgattactatgacctttatttgattcattggcctaaccctaaacaagaccagtatata
gaagcatggcaagccttaattgatgcacaaaagtttggtttgattcgttcaatcggcgtt
tctaactttttgccagaacatttaaaacgattagaaaaagaaacagacgtattgccaagt
atcaatcaaatcgaactccatccttattttactcaagaaaaacaactcgcttggaacaaa
gaacagggtattcaaacacaatcttggagtcctttaggcagagccaacgatatcttgcaa
aataaagccatcaaagaaatcgcagatacccacaaaaaatctatttcgcaaaccatttta
cgttggcatatccaattaggttctattccgattcctaagtcctcttcatttaaacaccaa
ttagacaacttatcgatttttgattttgtattgactgacgaagaaatgactctgatctct
gccttaaacaaaccagatggacgcaacaagaatcaagatccagctgaatatgaagagttt
taa

DBGET integrated database retrieval system