KEGG   Carnobacterium sp. CP1: NY10_1468Help
Entry
NY10_1468         CDS       T04230                                 

Definition
(GenBank) Nicotinamidase
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase Fn3_assoc
Motif
Other DBs
NCBI-ProteinID: ALV22073
UniProt: A0A0U3NNE3
Position
complement(1518133..1518654)
Genome map
AA seq 173 aa AA seqDB search
MLFIIDMQNDFVDNEKGKLPVPGAAAIVPKIIQEIKKQEEQGESIYYTLDQHDTEDDERS
KEEKQWGMDLYLPLKEALKNHTAIKKTFHSISPEDAAELKKEYGEDPDRLIEFVGVETNV
CVLSNAVMLHTSFPLASIRILKDMCVGTTPELHQAALDVMKSLKMEVQTSDET
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattattgatatgcaaaatgattttgttgataacgaaaaagggaaattacca
gtacctggtgcagccgcaattgttccaaaaatcatccaagaaataaagaaacaagaagaa
caaggcgaatcaatttattatactttggatcaacacgatacagaagacgatgagcgttct
aaagaagaaaaacaatggggtatggacttgtatcttcctttaaaagaggctttgaaaaat
cacacagctattaagaaaacttttcattctatctcgccggaagatgcagctgaactgaaa
aaagaatacggagaagatcctgatagacttattgaatttgtcggtgttgaaacaaatgtc
tgtgtcctctcaaatgcggtgatgcttcacacatcatttcctctagcctcaattcggatt
ttaaaagatatgtgtgtgggtacaacacctgaacttcatcaagcagctttggatgttatg
aagagcttaaaaatggaagtgcaaacttcagatgaaacctaa

DBGET integrated database retrieval system