KEGG   Carnobacterium sp. CP1: NY10_1471Help
Entry
NY10_1471         CDS       T04230                                 

Definition
(GenBank) Transcriptional regulator, LysR
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like ABC2_membrane_3 HTH_30
Motif
Other DBs
NCBI-ProteinID: ALV22076
UniProt: A0A0U3NR85
Position
1519940..1520821
Genome map
AA seq 293 aa AA seqDB search
MELRQLKYFITIANTRSYTAAAKSLFVTQPTLSWNIQQLEEEFNAHLFFQTKQGLQLTEK
GEKLLTRGQKVLDEFEGLIEDMHKMKPGKKNLKVGITVLFVIQYMEQIVQFTTMNPEVEL
TFVQSGSVEIQEKLAQNEIDIGLVSFPNYESSIEIERLNTSHSQYTVSVVLPFDHPLAQK
ETIEIKDLKGYDICSFSNDYVLGNILHERCSESGFHPNIIFTNKNWEVLLQNTLTTKALT
LMPQALERISNFKNLKWIPLKDKANFFEIGIAYKKNQNLEEHAIRFVNFMKKN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcgtcaattaaagtatttcatcacaattgctaatactagaagttatactgca
gctgcaaaaagtttatttgtcacacaacctactttaagttggaatattcaacaattggaa
gaagagtttaatgctcatttattttttcaaactaaacaaggacttcagttaacagaaaaa
ggagaaaagctactgacgcgcggacaaaaagtcttagatgaatttgaaggcttaatcgaa
gatatgcataaaatgaaacctgggaagaaaaacttgaaagtgggtatcaccgttcttttc
gttatccaatatatggaacaaatcgttcaatttacaactatgaatcctgaagttgaacta
acatttgttcaaagcgggtctgttgaaatccaagagaaacttgctcaaaatgaaatagat
attggcttggtttcttttcctaattatgaatcctctattgagatagaacggttaaatact
tctcattcccaatatactgtttctgtcgttttgccttttgatcatccgcttgcacaaaaa
gaaactattgaaatcaaagatttaaaaggttatgatatttgctctttttctaatgattat
gtactggggaacattctccacgaacgttgttcggaatctgggttccatcctaacataatc
tttactaataagaattgggaagttcttttacagaataccttgacaacaaaggctttaact
ttaatgcctcaagcattggagagaatcagcaattttaaaaatttgaaatggattccttta
aaagataaagcaaatttttttgaaataggcatcgcttataaaaaaaatcaaaatttggaa
gaacatgctatccgtttcgttaactttatgaaaaaaaattag

DBGET integrated database retrieval system