KEGG   Carnobacterium sp. CP1: NY10_1472Help
Entry
NY10_1472         CDS       T04230                                 

Definition
(GenBank) Butyrate kinase
  KO
K00929  butyrate kinase [EC:2.7.2.7]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00650  Butanoate metabolism
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NY10_1472
Enzymes [BR:carc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.7  butyrate kinase
     NY10_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK BcrAD_BadFG FGGY_C PilM_2 DRTGG
Motif
Other DBs
NCBI-ProteinID: ALV22077
UniProt: A0A0U3NLL4
Position
complement(1521004..1522089)
Genome map
AA seq 361 aa AA seqDB search
MTDHILAINPGATSTKIGYFEDDVLQWKHELTYSYEKVAEYQTIMEQYGFRYQDIADYLT
TKNLSAGSLDAVVGRGGLLPPVDAGAYLVNDAIMDCLKNRPILEHASNLGASLAKGISEK
FGTLECQAYIYDPVTVDQMEDVARISGLALIERKSIGHVLNMRAVCMKVAEDELKKPYEE
SNFVVAHVGGGSSASAHQKGRMIDLISDDEGLFSAERTGGLPLKEVIPLCYSYSRQEMTD
LTRKKGGLVSYFGTNDARAIEKKAQQGDAKAKIVLEAMAYQIAKTIGELATVLYGKVDGI
ILTGGLAHSARITELVKERTSFLAPVYIVPGEEELTALAKGARRVLTGQEKANIFRELAY
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcatatactagctattaatcccggtgctacttctactaaaatcgggtatttt
gaagatgatgtcctgcaatggaaacatgaactaacttattcttatgaaaaagtggctgaa
taccagactattatggaacaatatggatttcgttaccaagacattgctgattacttaacg
actaaaaatttgtcagcaggttctctagatgccgttgttgggcgaggaggattgttgcct
ccagtcgatgcaggggcgtacttggttaatgatgccattatggattgtttgaagaaccgc
cctattttagaacatgcatctaatttaggagcgagccttgcaaaagggatttctgaaaaa
tttggtactcttgaatgccaagcctatatctatgacccggtgacggttgaccaaatggaa
gacgtggctcgtatatcaggtttggcactgattgaacgaaaaagtatcggacatgtttta
aatatgcgggctgtttgtatgaaggttgctgaagacgagctgaaaaaaccttatgaagaa
agcaactttgtagtggcacatgtaggaggaggcagctctgctagcgctcaccaaaaaggg
cggatgatcgatttgatttcagatgatgaaggattgttttcagcagaacgtaccggcgga
ctaccgttaaaagaagttatcccgctgtgctacagctactctagacaagaaatgacagat
ctgactaggaaaaaaggcgggcttgtttcttactttggcacaaatgatgcacgagccatt
gaaaaaaaagctcaacaaggggatgcaaaagctaaaatcgtcttggaagcaatggcttac
caaatcgcaaaaacaattggtgagttagctaccgttctttatggaaaagtagacggtatc
attttaacaggaggtctggctcattctgctcgtattacagaattagttaaagaaagaact
tctttccttgctcctgtatacattgttcctggagaagaagaattgacagctttagccaag
ggtgcgcgacgtgtattgactggacaagaaaaagcaaatatttttcgagaacttgcttat
aattaa

DBGET integrated database retrieval system