KEGG   Carnobacterium sp. CP1: NY10_1473Help
Entry
NY10_1473         CDS       T04230                                 

Definition
(GenBank) Phosphate butyryltransferase
Organism
carc  Carnobacterium sp. CP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB EIIA-man DUF771
Motif
Other DBs
NCBI-ProteinID: ALV22078
UniProt: A0A0U3MDF2
Position
complement(1522091..1522888)
Genome map
AA seq 265 aa AA seqDB search
MVIPYLIGDEEAIKKHLSEITIKNASYIIVHAETDTEAAFKGIQLAKEGQVEFIMKGDLQ
TGTLLKEVVNHETGIRKQKVLSHLALIEVPAYPKLIGVTDGGMVLTPDIEQKKAIIKNAS
EVMQALGYQKAKFAVLSAAEVVQPKLPASVDAAELTKEFSHAPDMIVEGPISLDIALSPE
AAGEKRYQGKIQGDTDVLVAPDIVSGNALSKSMTLLAGGKMAGIIVGAEVPIILTSRSSS
AAEKRNSLLLALKVSQGANKKGVSE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttggtcattccgtatttgattggtgatgaagaagccatcaaaaagcatctgtcagaaata
acgattaaaaatgcatcgtatattatcgtgcatgctgaaacagatacagaagcagctttt
aaaggaattcaattggcaaaagaaggtcaagtcgagttcattatgaaaggcgatttgcag
acaggaacgttgttgaaagaagtagtgaatcatgaaacaggcattcgcaaacaaaaagta
ctgtctcatttagctttgattgaagtccctgcttacccaaagcttattggagtaaccgat
gggggaatggttttaactcccgacattgaacagaaaaaggccattatcaaaaatgcttca
gaagtgatgcaggctttaggttatcagaaggccaagtttgccgttctgtccgctgcagaa
gtcgtacagccaaaactcccggcttctgttgatgctgcagaactgaccaaagaattttct
catgcaccagacatgattgttgaaggcccgatttctttggatattgcattaagcccggaa
gcagccggcgagaaacggtatcaaggaaaaatacaaggagatacagacgtgttagtagcg
ccagacattgtatcaggcaacgctctttctaaaagtatgactcttttagctggcggaaaa
atggctggtatcattgtgggagctgaagttcctatcattttgacttccagaagttcttca
gctgcagagaaaagaaattcgcttctgctggctctcaaagttagtcaaggagctaataag
aaaggagtatctgaataa

DBGET integrated database retrieval system