KEGG   Carnobacterium sp. CP1: NY10_1843Help
Entry
NY10_1843         CDS       T04230                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00450  Selenocompound metabolism
carc00970  Aminoacyl-tRNA biosynthesis
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NY10_1843
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NY10_1843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:carc01007]
    NY10_1843
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:carc03016]
    NY10_1843
Enzymes [BR:carc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NY10_1843
Amino acid related enzymes [BR:carc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NY10_1843
Transfer RNA biogenesis [BR:carc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NY10_1843
 Prokaryotic type
   Other AARSs
    NY10_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALV22437
UniProt: A0A0U3F8J8
Position
1906411..1908435
Genome map
AA seq 674 aa AA seqDB search
MTERKTFYITTPIYYPSGKLHIGNAYSTIACDVMARYKRMQDFDVFYLTGSDEHGQKIEN
KAAELNITPQQYVDDMAEGMQNLWNLLEISNDKFIRTTDPVHEKVVADIFERFLAQGDIY
LDEYEGWYSVPDETFYTETQLVDVQHDAEGNVIGGKSPDSGHPVELIKEESYFFRMSKYA
DRLLAYYNEHPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFSWGINVPSNPKHVIYVWI
DALANYITALGYGTDDPSLFNKFWPADVHMVGKEIVRFHTIYWPIMLMALDLPLPKKIFG
HGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLMREVSFGSDGVFTPEDFVSRVNY
DLANDLGNLLNRTIAMINKYFDGTIPAYAGDVTAFDGELKATAEKTILDYQTEMENMQFS
NALSDVWVLISRANKYIDETEPWKLAKEESKKAELASVMAHLAESLRVAAILLQPFLTHA
PKEMFAQLGVETEAAKDWTAVQFGHFPADAKVVAKGTPIFPRLDIEAEVAYIKEQMDGGA
STLSEEEEIPAEWDPTETKLVSVKEKQIKYEDFDKVELKVAEVIDCGKVEGADKLLKFRL
DVGDEGHRQILSGIAEWYPNPEELIGKKVVIVANLKPRKMRGEISQGMILSAEKDGQLQL
IEAPMEAPNGSEVA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagagaaaaacattttatattacaacaccaatttattatccgagcggcaaactg
catattggaaatgcctattcaaccattgcttgtgatgtgatggcgcggtacaaaagaatg
caggattttgacgttttttaccttactggaagcgatgaacacggtcaaaaaattgaaaat
aaagcagcggaactaaatataacgccgcagcaatacgttgatgatatggctgaaggaatg
cagaatttatggaacttgcttgaaatcagcaatgataaatttattcggacgaccgatcct
gtccacgaaaaagtcgtagccgatatttttgagcgtttcttagcacaaggcgatatctat
ttggatgagtatgaaggctggtattctgttccagacgaaacattctacacagaaacacaa
ttagtagatgtgcaacacgatgcagaaggcaacgtgattggcgggaaatctcctgacagc
ggtcatccagtagaactgatcaaagaagaatcttatttctttagaatgagtaagtatgcg
gatcgtttattggcttactacaatgagcatcctgattttattcaaccagaatcacgtaaa
aatgaaatgatcaataactttatcaagcccggcttagaagatttagctgtttcgcggaca
actttttcttggggaatcaacgtgccaagcaatcccaaacacgttatttatgtctggatc
gatgcattggctaactatattaccgcattagggtatggaacagatgacccgagcttattt
aataaattctggccagcagatgttcacatggttggaaaagaaatcgtgcgtttccacacc
atttattggccaattatgttaatggcattggatttgccgttaccgaaaaaaatcttcggc
catggttggttattgatgaaagacgggaaaatgtctaaatcaaaaggcaacgttgtttat
ccagaaatgttagtggaacgctatggcttagacgcattacggtattatttgatgcgtgaa
gtttcatttggcagtgacggtgtctttacaccagaagattttgtttctcgggtcaattac
gacttagcgaatgatttaggtaatttactgaaccggactattgccatgatcaataaatac
tttgatggaacgattcctgcctacgcaggagacgtaacagcttttgacggagagctgaaa
gctacagcagaaaaaacgattttagattaccaaacagaaatggaaaatatgcagttcagc
aatgctttgagcgatgtttgggtgctgatttcacgtgcgaataaatatatcgatgaaaca
gagccttggaagttggctaaagaagaaagcaagaaagcagaattggcgagcgtcatggct
catttagccgaaagcttgcgtgttgctgcaattttactgcaacctttcttaacacatgca
ccgaaagaaatgttcgcacaattaggtgttgaaactgaagcagctaaggactggactgcc
gttcagtttggccatttcccggctgacgcgaaagtagtcgctaaaggaacgccgattttc
ccacgtttagacatagaagctgaagtagcttatattaaagagcaaatggacggcggagcc
agcactctttctgaagaggaagaaattccggcagaatgggacccaacggaaacaaaactg
gtttctgttaaagaaaagcaaatcaaatacgaagattttgataaagtggaattaaaagtg
gcagaagtaatcgactgcggaaaagttgagggagcggataaactgttgaaatttcgttta
gacgttggcgatgaagggcatcgacaaattctttctggaatcgctgaatggtaccctaac
cccgaagaattgatcggcaaaaaagttgttattgtggctaacttaaaaccgcgtaagatg
cgcggcgaaatcagccaaggaatgattttatctgctgaaaaagatggtcaattgcaattg
atcgaagctccaatggaagcaccgaacggatcagaagttgcttaa

DBGET integrated database retrieval system