KEGG   Carnobacterium sp. CP1: NY10_2048Help
Entry
NY10_2048         CDS       T04230                                 

Definition
(GenBank) Glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00030  Pentose phosphate pathway
carc01100  Metabolic pathways
carc01120  Microbial metabolism in diverse environments
carc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NY10_2048
Enzymes [BR:carc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     NY10_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 THF_DHG_CYH_C Epimerase
Motif
Other DBs
NCBI-ProteinID: ALV22635
UniProt: A0A0U3PE51
Position
2129787..2130572
Genome map
AA seq 261 aa AA seqDB search
MYKDLEGKVAVVTGGSKGIGNAIARRLSEEKMSVVINYHSDKEGAEETVADLKKLGGEAV
AVQADVGTEEGVDSLLKAALENFGGLDLWVNNAGMENQSPTHELKLEDWNKVLNVNLTGV
FLGSKAALNHYLEKNKKGNIINLSSVHERIPWPTFAHYSASKGGVKLFNETIALEYAHKG
IRVNSIAPGAINTPINAEKFEDPEKKESTLEMIPMNTIGKPEEVAAAAAWLASAESSYVT
GTTLFVDGGMSLYPSFEEGKG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagatttagagggaaaagttgcagtcgttactggaggctctaagggaatagga
aatgccattgctaggcgtttatcagaagaaaaaatgtccgttgtcatcaattaccacagc
gataaagaaggtgccgaagagacggttgctgatttgaaaaaattaggcggcgaagcagtt
gcggtacaagcagatgtgggaactgaagaaggagtagacagtttattgaaagcagctttg
gaaaattttggtggtttagatttatgggtcaataatgctggaatggagaatcaatctccc
acccatgaattgaaattggaggattggaacaaagtattgaacgtcaatttaacaggagta
ttcttaggttctaaagccgctttaaaccactatttagaaaaaaataaaaagggcaacatt
attaacctatcttctgttcatgaacggattccttggccgacatttgcgcattattcagca
agtaaaggcggagtgaagttgtttaatgaaacaatcgctttagaatatgcacataaaggc
attcgagtgaacagcattgcaccaggggctatcaacacgcccattaatgctgaaaaattt
gaagatccagagaaaaaagaaagtactttagagatgattccgatgaataccatcggaaaa
ccagaagaagtagctgcggccgctgcttggttagcttctgcagaatcaagttacgtaacg
ggcacgacattatttgtggatggtggaatgtcgctttacccatcatttgaagaaggaaaa
ggttga

DBGET integrated database retrieval system