KEGG   Carnobacterium sp. CP1: NY10_727Help
Entry
NY10_727          CDS       T04230                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00620  Pyruvate metabolism
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NY10_727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:carc02000]
    NY10_727
Enzymes [BR:carc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     NY10_727
Transporters [BR:carc02000]
 Other transporters
  Primary active transporters [TC:3]
   NY10_727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ALV21344
UniProt: A0A0U3PLZ4
Position
complement(685274..686695)
Genome map
AA seq 473 aa AA seqDB search
MTEKYLEITETVLRDAHQSLMATRMTTDEMLPIIEKMDRVGYYSLECWGGATFDAAIRFL
DEDPWERLREIKKRAPQTKLQMLLRGQNLLGYRHYADDIVDKFVEKASKNGIDVFRIFDA
LNDTRNLEASLKAVKRHGGHAELTICYTISEVHTIDYYAALADQLQQMGADSICLKDMAG
ILTPYTAEKLVKRLKEVLTIPLSLHTHATSGISQMTYLKAVEAGVDRIDTAISPFSEGTS
QPPTESMVLSLNEGNVKTRVDVALLEEIADYFKPIRDHYLASGILNPKMMGVDPKALLYQ
VPGGMLSNLYGQLEQAKATDKYDQVLKEVPKVREDLGYPPLVTPMSQMVGTQAVFNVLAG
ERYQMVPNEIKEYLRGSYGQSPVPVKEAFRKKIIKNEEVITDRPANHLSPEFDRLKAELG
DLAKKDEDVLTYAMFPQVGKAFLEKKYSQVKGSSMASKKEQQEKKAIKIIAVM
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaatacttggaaattacagaaacggttttacgagatgctcatcaaagcttg
atggccactcgtatgacgacggatgaaatgctgcccattattgaaaagatggaccgcgtc
ggctattattcactcgaatgttggggtggtgctacttttgatgcagctattcgtttctta
gatgaagatccctgggaaaggctgcgtgagatcaaaaaaagagctccgcaaacaaaactg
caaatgttattgagaggccaaaacctattggggtatcgtcattatgcagatgatattgta
gacaaatttgttgaaaaagctagtaaaaacggaatcgatgtatttcgtattttcgatgct
ttaaatgatacgcgtaacctggaggcttctttgaaagcggtcaagagacatggcggccac
gcggagttgacgatttgctatacgatcagtgaggtccatacgattgattactatgccgca
ctagcggatcaattgcagcaaatgggggcagattccatttgccttaaagatatggctggc
atcctaactccttatacagctgaaaagctggttaaaagattaaaagaagtgctgactatt
ccgctgagtcttcacactcatgcgaccagcggaatttcacaaatgacttatttaaaagcg
gtggaagctggagtggatagaatcgatacagccatttcgcctttttcagaaggaacaagc
cagcctccaactgaatcaatggtgctttctttaaatgaaggaaacgtaaaaacaagagta
gacgttgcattgctggaagagattgctgactattttaaaccgatacgagaccattatttg
gcttccggcatattgaaccctaagatgatgggtgttgaccctaaagctttattataccaa
gtgccaggtggaatgttgtctaatttgtacggccagttagaacaagcaaaagccactgat
aaatacgatcaagtattaaaagaagtaccaaaagtcagagaagatctagggtacccgcct
ttagtcaccccgatgagccaaatggtgggaacacaagcagtttttaatgtattggcaggg
gaaagataccaaatggtgccaaatgaaatcaaagaatacttgcgaggttcttatgggcaa
agcccggtacctgttaaagaagcttttcggaaaaagatcatcaaaaatgaagaagtcata
acggatcggccagctaatcatctttcaccggaatttgaccgcttaaaagctgaattagga
gatttggcaaaaaaagatgaagatgtcctaacgtatgctatgtttcctcaagtcgggaaa
gctttccttgaaaagaaatactcccaagtaaagggcagctcaatggcaagtaaaaaggaa
caacaagaaaaaaaggcaatcaaaataattgcggtgatgtaa

DBGET integrated database retrieval system