KEGG   Carnobacterium sp. CP1: NY10_728Help
Entry
NY10_728          CDS       T04230                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00010  Glycolysis / Gluconeogenesis
carc00020  Citrate cycle (TCA cycle)
carc00620  Pyruvate metabolism
carc01100  Metabolic pathways
carc01110  Biosynthesis of secondary metabolites
carc01120  Microbial metabolism in diverse environments
carc01130  Biosynthesis of antibiotics
carc01200  Carbon metabolism
Module
carc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NY10_728
   00020 Citrate cycle (TCA cycle)
    NY10_728
   00620 Pyruvate metabolism
    NY10_728
Enzymes [BR:carc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NY10_728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 Ubiq_cyt_C_chap AAA_29
Motif
Other DBs
NCBI-ProteinID: ALV21345
UniProt: A0A0U2VIH0
Position
complement(686800..688443)
Genome map
AA seq 547 aa AA seqDB search
MSTRETFQKSEIRKDNPFFSPLRAVIETSMYGNNVKNVTSLDEAYELALDAPGTIVTDLS
VKYTEKLDLPKDAKVLVENGGAVVGRTAAARRIVGNNKDEDAKLAVIVREAVYQGSLKKR
YKTAAYVGLDSEFMVKAHLSVPEGQENNLYSWLLNFQVTNDLYNKMYAASREIEAGDIFI
YSDPNWQHPDYPLGLAYFDTDHNAAIILGMNYFGELKKATLTLAWGTAHRMGYASCHGGQ
KKFTLADGTNYVSAFFGLSGSGKSTLTHAKHNHKYQIEVLHDDAFIISLTDGSSIALEPA
YFDKTQDYPSDHEEVDYFVTVQNVAVTLDENGEKVLLTEDLRNGNGRTVKSRYSTPNRVD
RIDEPIDAIYWIMKDESLPPVIKVEDPILAASFGATLATKRSSAERLKEGVDMDKLVIVP
YANPFRVYPLAEDYQQFKQLFEEREIECYILNTGFFLDKKITPAVTLKSIESIVDGTAEF
ESFGGNEQMSYLKVAGYEPDFMDEAYKQLVFDRMQMRVEHIQEKNAADGMDVLPDEALKT
LEKIINR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccagagaaacgtttcaaaagtcagaaattagaaaagataatccctttttttcc
cctttacgagcagtaatcgagacctctatgtacggcaacaatgtgaaaaatgtaacgagt
ctagatgaagcatacgaattagcgcttgatgcgccaggtaccatcgtaacggacttatca
gtaaaatatacggaaaaattggatttgcctaaagatgcaaaagttttagtcgaaaacgga
ggagcagtggttgggagaacggcagctgcccgaagaatcgtagggaataataaagatgaa
gacgctaagttagctgtaatcgtaagagaggctgtttaccaggggtctttgaaaaaacgt
tataaaacagctgcttatgtagggttagattcagaattcatggtgaaggcccatctttca
gtgccagaaggtcaagaaaacaatttatattcttggctgttaaactttcaagtaacaaac
gatttatacaataaaatgtatgccgcttctcgtgaaattgaagctggggacatttttatt
tattctgatcctaactggcagcatcctgattatcctctcggtttagcctattttgatacg
gaccacaatgcagctattattctgggcatgaattatttcggcgaactgaaaaaagctaca
ttgactttagcatggggcacagctcatcggatgggatatgcttcttgtcatggaggccaa
aagaaattcacattagcggatggaacaaattatgtttcggctttctttggattatctggc
tctggaaaatctacattgacacatgctaaacacaaccataaataccaaattgaagtctta
catgatgatgctttcattatttctttaaccgatgggtcttccattgctctggaaccggct
tactttgacaaaacacaagattacccttcagatcatgaagaagtcgactattttgttaca
gtccaaaatgtggccgtcacgttagatgaaaatggagaaaaagttctgctgacggaggat
ttacgtaatggaaatgggcgtacagttaaatcgcgttattctactcctaaccgtgttgac
cggattgatgagcccattgacgctatttattggattatgaaagatgaaagtttgccgccc
gttattaaagtagaagatcctattttagcagcgagctttggagcgacattggctactaaa
cgttcatcagctgagcggttaaaagaaggagtagacatggataaattagtaattgtccct
tatgcaaatcctttccgtgtttatccattggcagaagactatcaacaatttaaacagctt
tttgaagagcgagaaatagagtgttatattttgaataccggctttttcttagataaaaaa
attactcctgctgtgacactgaaaagcattgagtcgattgttgatggaactgcagaattt
gagtcttttggcggaaatgagcagatgagttatttaaaagtagcaggttatgagccggat
ttcatggatgaagcctataaacaattggtttttgatcgcatgcaaatgcgcgtagaacac
atacaagaaaaaaacgcagcagatggaatggatgttttacctgatgaagcattgaaaacg
ttggaaaaaattattaatcgctga

DBGET integrated database retrieval system