KEGG   Collimonas arenae: LT85_0030Help
Entry
LT85_0030         CDS       T03512                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
care  Collimonas arenae
Pathway
care00010  Glycolysis / Gluconeogenesis
care00053  Ascorbate and aldarate metabolism
care00071  Fatty acid degradation
care00280  Valine, leucine and isoleucine degradation
care00310  Lysine degradation
care00330  Arginine and proline metabolism
care00340  Histidine metabolism
care00380  Tryptophan metabolism
care00410  beta-Alanine metabolism
care00561  Glycerolipid metabolism
care00620  Pyruvate metabolism
care00625  Chloroalkane and chloroalkene degradation
care00903  Limonene and pinene degradation
care01100  Metabolic pathways
care01110  Biosynthesis of secondary metabolites
care01120  Microbial metabolism in diverse environments
care01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LT85_0030
   00053 Ascorbate and aldarate metabolism
    LT85_0030
   00620 Pyruvate metabolism
    LT85_0030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LT85_0030
   00561 Glycerolipid metabolism
    LT85_0030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LT85_0030
   00310 Lysine degradation
    LT85_0030
   00330 Arginine and proline metabolism
    LT85_0030
   00340 Histidine metabolism
    LT85_0030
   00380 Tryptophan metabolism
    LT85_0030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LT85_0030
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LT85_0030
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LT85_0030
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LT85_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIY39190
UniProt: A0A0A1F5X4
Position
47438..48880
Genome map
AA seq 480 aa AA seqDB search
MDTIATGSDSGLNQINSEIQRVFALQRATALRLRQSTKAERIAKIRKLKAALLANREAVI
AAGFADFGKPATEVELTEILPVIAEANDALRKLGGWMKPKKVWPSRMAVGTQGYMQYEPK
GRVLIVAPWNYPVNLSLGPLVSALAAGNAVIIKPSEMTPHASAVIGKIVREVFTEDEVAL
FEGPAPVAQALLELPFDHIFFTGSPAVGKIVMAAAAKNLTSVTLELGGKSPTIVDETADL
NMAAKNILWAKFTNNGQTCIAPDHIYVHASVKDEFLRHCIAALEEAYGKDAQQIDSPCLA
RIVNERHAERVKALLDDATARGARVVTGGQVDAGQRYIAPTLIDGIPDDAKIMSEEIFGP
LLPIISFTELSTVIARINADPKPLALYVWSRKQENIDKVMQQTTSGGACINHCVVQFLHG
NLPFGGVNNSGIGSGHGHHGFLAFSHERAVVRGRIMLAKMFYPPYTGMTRRLVNLFIKTV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggacaccattgcaacaggaagcgatagcgggctgaaccagattaacagcgaaatccag
cgcgtttttgcgctccagcgcgctaccgcactgcgcttgcgccaatccaccaaggccgag
cgcatcgccaagatccgcaaactgaaagctgcattgctggcgaatcgcgaagcggtgatt
gctgcggggtttgccgatttcggcaagcccgccaccgaagtcgagctgacggaaatcctg
ccggtgatcgccgaagccaatgacgcactccgcaagctgggcggctggatgaagccgaag
aaggtgtggccatcgcgtatggcggtcggcacccagggttacatgcagtatgagccgaag
ggccgggtgctgatcgtcgcgccgtggaactatccggtcaatctgagcctggggccgctg
gtgtcggcgctggcggcgggtaacgcggtgatcatcaagccgtcggaaatgacgccgcat
gcttccgccgtcatcggcaagattgtgcgcgaggtgtttaccgaggatgaggtggcgttg
ttcgaggggccggcgccggtggcgcaagccctactggagctgccgttcgaccatatcttt
tttaccggctcgcccgccgtcggcaagatcgtcatggcggctgcggctaaaaatcttacc
agcgtgacgctggaactgggcggcaaatcgccgaccatcgtcgacgagacagccgatttg
aacatggcggccaagaatatcctttgggccaagttcaccaacaacggccagacttgtatc
gcgcctgatcacatctacgtgcatgccagcgtcaaggacgaattcctgagacattgtatt
gcggcgctggaagaagcctacggcaaggacgcgcagcagatcgacagcccttgcctggcg
cgtatcgtcaatgagcgccatgccgagcgcgtcaaggcgctgctggatgacgctaccgca
cgcggtgcgcgggtggtgacgggcggccaggtcgatgctggccagcgttatatcgcgccg
acgctgatcgacggcattcccgacgacgccaagatcatgagcgaagaaatcttcgggccg
ctgctgccgattatcagctttactgagctcagtacggtgatcgcccgcatcaacgccgac
cccaagccgctggccttgtacgtatggagccgcaagcaggaaaacatcgacaaggtcatg
cagcagaccacctctggcggcgcttgcatcaaccattgcgtggtgcagttcctgcatggg
aacctgcccttcggcggcgtcaataattccggcatcggcagcggccacggccatcatggc
ttcctggcgttttcgcatgagcgggccgtggtgcgcggccgcatcatgctggcaaagatg
ttttacccgccctatacgggcatgacgcgcaggctggtcaacctgttcatcaagacggtt
tga

DBGET integrated database retrieval system