KEGG   Collimonas arenae: LT85_0775Help
Entry
LT85_0775         CDS       T03512                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
care  Collimonas arenae
Brite
KEGG Orthology (KO) [BR:care00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LT85_0775 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIY39935
UniProt: A0A0A1F817
Position
874047..874421
Genome map
AA seq 124 aa AA seqDB search
MAAYEFTVTVRTQYLEEQSQPDSSHYVFAYAITIKNTGQVAAQLISRHWVITDANNHVEE
VRGLGVVGHQPLLQPGEQFEYTSGTSMATPQGSMLGEYFCVAEDGEQFEARIPEFILSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctatgaatttaccgtcactgtcagaacccagtatctggaagaacaatcccag
ccggacagttcgcactatgtatttgcctatgcgataacgatcaagaatactgggcaagtc
gcggcgcagctgatttcgcgccattgggtcatcaccgacgccaacaatcatgtggaagaa
gtgcgcggccttggcgtggtcggccatcagccgctgttgcaaccgggagagcagttcgaa
tacaccagcggcacctcgatggcgacaccgcaaggttcgatgctgggcgaatatttttgc
gtggccgaagacggcgagcaatttgaagcccgcattccagaattcatcctatccctgccg
cgtaccctgcactga

DBGET integrated database retrieval system