KEGG   Collimonas arenae: LT85_0823Help
Entry
LT85_0823         CDS       T03512                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
care  Collimonas arenae
Pathway
care00053  Ascorbate and aldarate metabolism
care01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    LT85_0823
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     LT85_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_10 NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AIY39983
UniProt: A0A0A1F5I6
Position
complement(932107..932892)
Genome map
AA seq 261 aa AA seqDB search
MKTIVLTGAAGNIGKVLREQWSDGRYQLRLNDIKPLGELATHETAYIGDLRDAGFCTELL
KGADTVVHMAGIGTDLELDLLIEHNLKALLSLYQAASTHAVRVIYASSNHAIGMYASETD
IDEHAAVRPDSLYGVSKVWGEAIARLYFDKHGVESICLRIGSFETEPFERRHLHTWLSHA
DMQHLVERCIEALHPGFHIMYGVSANTRNWWRQRDNPIGYHPQSNAEDFAERIASIPTRG
GPLAELFQGGGFAASDYTKKT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcgtccttaccggcgctgccggcaatatcggcaaggtcctcagggagcaa
tggtcggatggtcgctatcagctgcggctgaacgacatcaaaccgctgggcgaacttgcc
acgcatgaaacagcatacatcggcgatctgcgcgatgcgggcttttgtacagagttgcta
aaaggcgcagacaccgtggtgcacatggcgggcatcggcaccgatctggaactggacctg
ctgatcgagcacaatctgaaagccttgctcagtctgtaccaggctgccagcacacatgct
gtacgcgtgatctatgccagttccaaccatgctatcggcatgtatgcatcggagaccgac
atcgacgaacatgcggcagtgcggccggacagcctttacggcgtcagcaaagtctgggga
gaagcgatcgccaggctgtatttcgacaaacatggcgttgaatcgatttgcctgcgtatc
ggctcattcgagaccgagccgttcgaacggcgtcatttgcacacatggctgtcgcatgcc
gatatgcagcacctggtggagcgctgtatcgaagcgctgcatccgggattccatatcatg
tacggcgtttcggccaatacccgcaactggtggcgacaacgcgacaatccgattggatat
cacccgcaaagcaatgcggaagattttgccgagcggattgccagtattccgacccgcggc
ggtccactggccgagctgttccaaggtggcggttttgcagcatccgactacacgaaaaaa
acatga

DBGET integrated database retrieval system