KEGG   Collimonas arenae: LT85_1229Help
Entry
LT85_1229         CDS       T03512                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
care  Collimonas arenae
Pathway
care00020  Citrate cycle (TCA cycle)
care00480  Glutathione metabolism
care01100  Metabolic pathways
care01110  Biosynthesis of secondary metabolites
care01120  Microbial metabolism in diverse environments
care01130  Biosynthesis of antibiotics
care01200  Carbon metabolism
care01210  2-Oxocarboxylic acid metabolism
care01230  Biosynthesis of amino acids
Module
care_M00009  Citrate cycle (TCA cycle, Krebs cycle)
care_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LT85_1229
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LT85_1229
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LT85_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIY40387
UniProt: A0A0A1FC03
Position
1375469..1376722
Genome map
AA seq 417 aa AA seqDB search
MSQHIKVPAEGKKITVNADFSINVPDNPIIPYIEGDGTGVDISPVMIKVVDAAVAKAYGG
KRKISWMEVFAGEKSTKVYGPDVWLPEETLAAIKDYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEWQEGSEGAKKLIEFL
VKEMGVKKIRFPNTSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEG
GFRDWAYALAQKEFGAELIDGGPWAKFKNPKTGREIIVKDSIADAFLQQILLRPNEYSVI
ATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSLILS
AEMMLRHMGWVEAADLIIDAMQKSITSKRVTYDFARLMEGATQVSCSGFGGVLIENM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacatatcaaagtgcctgctgaaggcaagaaaatcaccgtcaacgctgatttt
tctatcaacgtcccagataatccaatcattccatacatcgaaggcgacggcaccggcgtg
gatatcagcccggtcatgatcaaggtggtggatgcggctgtggccaaggcgtacggtggt
aagcgcaagatcagctggatggaagtgtttgccggcgaaaagtcgaccaaagtatatggt
cctgacgtctggctgccggaagaaacgctggccgcaatcaaggattatgtggtgtcgatc
aaaggtccgttgacgacgccggtcggcggtggcatccgttcgctgaacgtcgccctgcgc
caggagctggacttgtatgtctgcctgcgccccgtacgttatttcaagggcgtgccttcg
ccagtgcgtgagccggaaaagaccgacatggtgatcttccgcgaaaattcggaagatatc
tatgccggtatcgaatggcaagaaggcagcgaaggcgccaagaagctgatcgagttcctg
gtcaaggaaatgggcgtcaagaagatccgtttcccgaacacgtccggtatcggcatcaag
ccggtgtcgcgggaaggtaccgaacgtcttgtgcgtaaggcgatccagtacgccatcgac
aacgacaagccatccgtgacgattgtccacaagggcaatatcatgaagttcaccgaaggt
ggtttccgtgactgggcatatgccctggcgcaaaaggaatttggcgcagagctgatcgat
ggcggcccatgggcgaaattcaaaaacccgaaaacgggtcgcgaaattatcgtcaaggac
tcgatcgctgatgcatttttgcaacaaattttgttgcgtccgaatgaatatagcgtcatc
gccaccttgaatctgaatggcgactacatctccgatgcgctggcagcacaagtcggcggc
atcggcatcgcacctggcgccaacctgtcggattcggtggccatgtttgaagcgacccac
ggcacagcgccgaaatatgcaggcaaggactatgtgaacccaggttcgctgatcctgtcg
gcggaaatgatgctgcgccacatgggctgggtggaggcggctgacctgatcatcgacgcg
atgcagaaatcgatcacctcgaaacgggttacttacgacttcgcccgcctgatggaaggc
gcaacccaggtttcctgctcgggtttcggcggcgttctgatcgaaaacatgtaa

DBGET integrated database retrieval system