KEGG   Collimonas arenae: LT85_2071Help
Entry
LT85_2071         CDS       T03512                                 

Definition
(GenBank) hypothetical protein
Organism
care  Collimonas arenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4148
Motif
Other DBs
NCBI-ProteinID: AIY41229
UniProt: A0A0A1FC46
Position
2285263..2285529
Genome map
AA seq 88 aa AA seqDB search
MNIKQMTVFFASMAMAGSVVASAPVAEKTRADVLRELEQARAAGQMSVPDAQYPRLADGA
SKSGMAAPSAAITDCKTHRNIDPVYSGA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaacaaatgaccgtatttttcgcttctatggccatggccggtagcgtcgtg
gcatccgcaccggttgcggaaaagacccgcgccgacgtactgcgcgagctggaacaagcc
cgcgccgctggccagatgtcggtgccggatgcgcaatacccgcggctagcagatggcgcc
agcaagagcggaatggcagcgccgtcagccgctatcacggattgcaaaacccacagaaat
atcgatccggtttactcgggagcctga

DBGET integrated database retrieval system